KEGG   Labrenzia sp. VG12: CHH27_05755Help
Entry
CHH27_05755       CDS       T04984                                 

Definition
(GenBank) CoA ester lyase
  KO
K08691  malyl-CoA/(S)-citramalyl-CoA lyase [EC:4.1.3.24 4.1.3.25]
Organism
labr  Labrenzia sp. VG12
Pathway
labr00630  Glyoxylate and dicarboxylate metabolism
labr00660  C5-Branched dibasic acid metabolism
labr00680  Methane metabolism
labr01100  Metabolic pathways
labr01120  Microbial metabolism in diverse environments
labr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:labr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CHH27_05755
   00660 C5-Branched dibasic acid metabolism
    CHH27_05755
  09102 Energy metabolism
   00680 Methane metabolism
    CHH27_05755
Enzymes [BR:labr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.24  malyl-CoA lyase
     CHH27_05755
    4.1.3.25  (S)-citramalyl-CoA lyase
     CHH27_05755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HpcH_HpaI C-C_Bond_Lyase
Motif
Other DBs
NCBI-ProteinID: ASP32812
UniProt: A0A222F2M7
Position
complement(1271890..1272930)
Genome map
AA seq 346 aa AA seqDB search
MKTPSAYYKPLAIGAPAPFRELPVTLERMIHFVPPHVEKMRAKVPDLINKVDVVLGNLED
AIPAEAKTDARRGFIQLASENDFGATGLWTRVNCLNSPWFLDDLLEIVPAVGDKLDVVML
PKVEGAWDIHYLDQLLAQLEARSGISKPIMIHAILETAEGVKNVEQIAAASPRMHGMSLG
PADLAASRGMKTTRVGGGHPDYAVLSDANPDGARTAYQQDLWHYTVGKMVDACLSYGLKP
FYGPFGDFADAAACESQFRNAFLMGCLGAWSLHPTQIDIAKKVFSPDPQEVGFAKRILEA
MPDGTGAVMIDGKMQDDATWKQAKVIVDLAKLVASKDTELAAVYGL
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccccaagtgcatattacaaaccgcttgcaatcggtgcccctgcccctttccgg
gagctgccggtaacgctggaacggatgatccacttcgtgccgccacatgttgaaaagatg
cgggcaaaggtgccggacctgatcaacaaggtggatgtggttctgggcaacctggaagat
gcgatcccggctgaggccaagacggatgcgcgtcgcggtttcatccagctggccagcgaa
aatgacttcggtgcgaccggcctctggacacgggtcaattgtctgaacagtccctggttc
ctcgacgatcttctggaaatcgttcccgcagttggtgacaagcttgatgtcgtcatgctt
cccaaggtcgaaggggcctgggacatccactatctcgatcagctcctggcccagctggaa
gcacgctccggtatttccaaaccgatcatgatccacgctatcctggagacagcggaaggc
gtgaagaatgtcgagcagattgcggcagccagtccgcgcatgcatggcatgagccttggt
ccggccgaccttgccgcctcacgcggcatgaaaacaacgcgggtcggcggcggccacccc
gactacgccgtgctttcggacgccaatccggacggagccaggacggcctatcagcaggac
ctgtggcactacacggtcggcaagatggtcgacgcgtgtctgtcctatgggctgaaaccc
ttttatggaccctttggcgactttgccgatgcggccgcctgtgaaagtcagttccgcaac
gctttcctgatggggtgtctcggcgcctggtcactgcatccgacccagatcgacattgcc
aagaaggtgttttcgccggatccgcaggaagtcggctttgccaagcgcatcctggaggcg
atgccggacggcaccggtgcggtaatgatcgatggcaagatgcaggacgatgcaacctgg
aaacaggcgaaggttatcgtagaccttgcaaaactggttgcatcgaaagacactgaactc
gcagcggtctatggtctttag

DBGET integrated database retrieval system