KEGG   Labrenzia sp. VG12: CHH27_19085Help
Entry
CHH27_19085       CDS       T04984                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
labr  Labrenzia sp. VG12
Pathway
labr00071  Fatty acid degradation
labr00072  Synthesis and degradation of ketone bodies
labr00280  Valine, leucine and isoleucine degradation
labr00310  Lysine degradation
labr00362  Benzoate degradation
labr00380  Tryptophan metabolism
labr00620  Pyruvate metabolism
labr00630  Glyoxylate and dicarboxylate metabolism
labr00640  Propanoate metabolism
labr00650  Butanoate metabolism
labr00900  Terpenoid backbone biosynthesis
labr01100  Metabolic pathways
labr01110  Biosynthesis of secondary metabolites
labr01120  Microbial metabolism in diverse environments
labr01130  Biosynthesis of antibiotics
labr01200  Carbon metabolism
labr01212  Fatty acid metabolism
labr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:labr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CHH27_19085
   00630 Glyoxylate and dicarboxylate metabolism
    CHH27_19085
   00640 Propanoate metabolism
    CHH27_19085
   00650 Butanoate metabolism
    CHH27_19085
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CHH27_19085
   00072 Synthesis and degradation of ketone bodies
    CHH27_19085
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CHH27_19085
   00310 Lysine degradation
    CHH27_19085
   00380 Tryptophan metabolism
    CHH27_19085
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CHH27_19085
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CHH27_19085
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CHH27_19085
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:labr04147]
    CHH27_19085
Enzymes [BR:labr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CHH27_19085
Exosome [BR:labr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CHH27_19085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ASP35083
UniProt: A0A222FA11
Position
4118514..4119695
Genome map
AA seq 393 aa AA seqDB search
MTEIVIASAARTAVGSFGGALKDSPPCDLGTTVAKAAIERAGIEASSIDQAFFGNVIHTE
PRDMYLARVASRQAGVPDHAPALTMNRLCGSGLQAIVSAVQAITLGDGDVALAGGAENMS
RAGYSLPGARFGQKMGDTQIVDMMTGALHDPFGIGHMGITAENIAEKHDIPRERQDAFAL
ESHRRASAAIKAGYFKDQIVPISVGRRGKETVFDTDQHVRHEAEIGDMARLRPVFKKDGS
VTAGNASGLNDGAAALVLMSREKADALGVKPLARIRSYGVAGVDPAVMGIGPVPAMQIAM
KRAGISAVDLDAVESNEAFAAQACAVNDLLGLPAEKVNPNGGAVALGHPIGATGAIIMTK
LVYELRRSGGSLGAATMCIGGGQGIAVIVENAA
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgactgagattgtgattgcaagtgcggcgcggacagccgttggaagtttcggcggcgcg
ctgaaggacagcccgccctgcgacctgggcacgacggtcgcaaaagccgccatcgaacgc
gcagggatcgaagcaagttccatcgatcaggcgttctttggcaatgtcatccacaccgaa
ccgcgtgacatgtatctggcgcgtgtcgcctcccgccaggccggcgtcccggaccacgcg
ccggcactgaccatgaaccgtctgtgcggcagcggtctgcaggccatcgtctccgcggtc
caggcgatcacgctgggagacggcgacgtcgcgttggcagggggcgctgaaaacatgagc
cgcgccggctattcgctgccgggcgcccgtttcggccagaaaatgggcgatacccagatc
gtcgacatgatgaccggcgctctccacgacccgttcggcatcggccacatgggcatcacg
gccgagaacatcgccgaaaaacacgacatcccgcgcgaacgccaggatgcctttgctctg
gaaagccatcgccgcgccagcgccgccatcaaggccggctatttcaaggatcagatcgtg
ccgatcagcgtcggccggagaggcaaggagacggtcttcgacaccgaccagcatgttcgt
catgaggcggagatcggcgacatggccaggctgcgcccggttttcaagaaggacggcagc
gttactgccggcaacgcctcaggcctcaatgacggtgccgcggcgcttgtcctgatgagc
agggaaaaagccgacgcgcttggtgtgaagccgctggcgcgcatccgctcctatggggtg
gcaggcgttgacccggcggtgatgggcattggcccggttccggccatgcagatcgccatg
aaacgcgccggcatttccgcagtagatctcgatgcggtggaatccaacgaggcctttgcg
gcccaggcctgcgccgtcaacgatctgcttggcctgcccgcagagaaggtcaatccgaat
ggcggtgccgtcgcgcttggccacccgatcggtgccaccggcgcgatcatcatgaccaaa
ctggtctacgaattgcggcgcagcggcggcagcctcggcgccgccaccatgtgcatcggc
ggcggccagggcattgcggtgatcgtggaaaacgcggcctag

DBGET integrated database retrieval system