KEGG   Labrenzia sp. VG12: CHH27_19715Help
Entry
CHH27_19715       CDS       T04984                                 

Gene name
rocF
Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
labr  Labrenzia sp. VG12
Pathway
labr00220  Arginine biosynthesis
labr00330  Arginine and proline metabolism
labr01100  Metabolic pathways
labr01110  Biosynthesis of secondary metabolites
labr01130  Biosynthesis of antibiotics
labr01230  Biosynthesis of amino acids
Module
labr_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:labr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    CHH27_19715 (rocF)
   00330 Arginine and proline metabolism
    CHH27_19715 (rocF)
Enzymes [BR:labr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     CHH27_19715 (rocF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ASP35194
UniProt: A0A222F9R8
Position
4239353..4240294
Genome map
AA seq 313 aa AA seqDB search
MNVVKKQIVLVGAPVDEGAGQRGCLMGPDAYRTAGLAETLEALGHTVVDHGNLQPADVGK
LTPPNPVLKNYPAYVAWTRSLHDKAAELGEAPVVPVYLGGDHAMAAGTVSGQARAAAAQN
RPLFVLWLDAHSDFHTFDSTDSGNLHGTPLAFLCGLPGFDDMLGAPFEHTLKPENVEILG
VRSIDDEERKLLLDHGVGVSDMRRIDEEGIHNLLRPFLERVRAENGLLHVSLDVDFLDPG
IAPAVGTTVPGGASFREAHLVMEMLHDSGLVTSLDLVELNPFLDERGKTARLMVDLTGSL
FGRRVFDRPTRSF
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgtcgtcaagaaacagatcgtcctggtcggcgcgccggtggatgaaggcgcaggc
cagcgtggctgcctgatggggccggatgcctatcggacagcaggccttgccgaaacactg
gaggcgctgggccataccgtcgttgaccacggtaacctgcagcccgcggatgttggcaag
ctgacgccgccgaacccggttctgaagaactacccggcctatgtggcctggacgcgatct
ctgcacgacaaggcagctgaactcggcgaagcgccggtggttccggtctatctgggtggt
gaccatgccatggcggctggcaccgtttccggtcaggcgcgggctgcggcggcgcagaac
cggccgctattcgtgctgtggctcgacgcccattcggacttccacaccttcgacagtacg
gacagtggcaacctgcacggcaccccgcttgcgtttctgtgcggcctgccgggctttgac
gacatgcttggcgctccgttcgagcacaccctcaagccggaaaatgtcgagatcctcggt
gtgcgttccattgacgatgaagagcgcaagctgttgctcgaccatggcgtcggcgtcagc
gacatgcgccgcattgacgaggaaggcatccacaacctgttgcggccgttcctggagcgg
gtgcgcgccgagaatggcctgctgcatgtcagcctcgatgtcgatttcctcgatcccggc
attgcaccggccgtcggcacgaccgtgccgggcggggcgtccttccgcgaggcccacctg
gtcatggaaatgctccacgacagcggccttgtcacctcgctcgatctcgtcgagctcaac
cctttcctggacgaacgcggaaaaaccgcgcgtctcatggtcgacctgaccggcagcctg
ttcggccgccgggtcttcgaccgcccgaccagaagtttttaa

DBGET integrated database retrieval system