KEGG   Labrenzia sp. VG12: CHH27_22090Help
Entry
CHH27_22090       CDS       T04984                                 

Definition
(GenBank) phosphoenolpyruvate carboxykinase (ATP)
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
labr  Labrenzia sp. VG12
Pathway
labr00010  Glycolysis / Gluconeogenesis
labr00020  Citrate cycle (TCA cycle)
labr00620  Pyruvate metabolism
labr01100  Metabolic pathways
labr01110  Biosynthesis of secondary metabolites
labr01120  Microbial metabolism in diverse environments
labr01130  Biosynthesis of antibiotics
labr01200  Carbon metabolism
Module
labr_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:labr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CHH27_22090
   00020 Citrate cycle (TCA cycle)
    CHH27_22090
   00620 Pyruvate metabolism
    CHH27_22090
Enzymes [BR:labr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     CHH27_22090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_25
Motif
Other DBs
NCBI-ProteinID: ASP35596
UniProt: A0A222FAE0
Position
complement(4765468..4767078)
Genome map
AA seq 536 aa AA seqDB search
MQEVGVRNPSIGCETFGFKGLKALYWNQNEPALYEYSLSRGETKLAAGGAIVAETGIHTG
RSPKDKFVVFDEETRDTVWWDNNAQMPKDKFDLLLADFLAHAEGMELFAQDLYGGADATH
RLPVRVYTEFAWHSLFIRNLLLRPEVSELEAFAPDMTIIDLPSFKADPARHGCRTETVIA
VDLTRKIVLIGGTSYAGEMKKSVFTMLNHLLPAKGVMSMHCSANVGDEGDTAVFFGLSGT
GKTTLSADPARTLIGDDEHGWSESGVFNFEGGCYAKTIKLSAEAEPEIHSTTQRFGTVLE
NVVLDDQRVPDFNDGSKTENTRAAYPIHFISNASDTGCAPMPKTIIMLTADAFGVMPPIA
RLTPAQAMYHFLSGYTAKVAGTEKGVTEPQATFSTCFGAPFLPRHPSEYGNLLKDLIARH
NVDCWLVNTGWTGGAYGTGNRMPIKATRTLLTAALNGSLKDADFRTDANFGFEVPVSVDG
VDDTILTPRDTWDDKAAYDVQAAKLVDMFVSNFEAFEDHVDGAVKSAAPACRMAAE
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaagtaggtgtcaggaatccctccattggctgcgaaacctttggcttcaagggg
ctgaaggcgctctattggaaccagaacgagcctgcgctttacgagtattccctgtcccgc
ggcgaaacgaagctggctgccggcggcgcgattgtcgcggaaaccggcattcacaccggc
cgctcccccaaggacaagttcgttgtcttcgacgaggaaacccgggacacggtctggtgg
gacaacaatgcgcagatgccgaaggacaagttcgatctgctgcttgccgatttcctggct
catgcggaaggcatggaactgttcgcacaggatctttacggcggtgcggacgccacgcac
cggctgccggtccgggtctataccgaattcgcctggcattcgcttttcatccgcaatctt
ctgctgcggcctgaggtgagcgaacttgaagcgtttgccccggacatgacgatcatcgat
ctgccgagcttcaaggccgatccggcgcggcacggttgccgcaccgaaacggtgatcgcc
gtcgacctgacccgcaagatcgtgttgatcggcggcacgtcctatgccggcgagatgaag
aagtccgtcttcaccatgctcaatcacctgttgccggccaaaggcgtgatgtcgatgcac
tgctcggccaatgtgggcgatgaaggcgacacggctgtcttcttcggtctctccggcacc
ggcaagaccacactgtcggcagacccggcccgcacgctgatcggcgacgacgagcatggc
tggtcggaaagcggcgtcttcaatttcgagggcggctgttacgccaagaccatcaagctc
agcgccgaggccgaaccggaaatccattccacgacccagcgtttcggcacggtcctggaa
aatgttgttctcgacgaccagcgtgttccggatttcaacgacggttcgaagaccgaaaat
acgcgcgccgcttatccgatccacttcatttccaatgccagcgacaccggctgtgcgccg
atgccgaagacgatcatcatgctgaccgccgatgcctttggcgtgatgccgccgattgcg
cggctgacgccggcccaggccatgtaccacttcctgtccggttacacggcaaaggtggcc
ggcaccgaaaagggtgtcaccgagccgcaggcgaccttttccacctgcttcggcgcaccg
ttcctgccgcggcacccgtcggaatacgggaacctgctgaaggacctgatcgccaggcac
aatgtcgattgctggctggtaaataccggctggaccggcggcgcctatggcaccggcaac
cgcatgccgatcaaggcaacccgcacactcctgaccgccgctctcaacggcagcctgaag
gatgcggacttccgcaccgacgccaatttcggctttgaggtcccggtctccgtggacggg
gtcgacgacacgatcctgacaccgcgcgacacctgggacgacaaggcagcctatgacgtt
caggccgccaagctggtcgacatgttcgtcagcaatttcgaggcattcgaggatcatgtc
gacggcgctgtcaaaagcgcggctccggcctgccggatggctgcggaataa

DBGET integrated database retrieval system