KEGG   Lactobacillus acidophilus NCFM: LBA0319Help
Entry
LBA0319           CDS       T00231                                 

Gene name
cbiO
Definition
(RefSeq) cobalt transporter ATP-binding subunit
  KO
K16786  energy-coupling factor transport system ATP-binding protein [EC:3.6.3.-]
Organism
lac  Lactobacillus acidophilus NCFM
Pathway
lac02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:lac00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    LBA0319 (cbiO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lac02000]
    LBA0319 (cbiO)
Enzymes [BR:lac01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.-  
     LBA0319 (cbiO)
Transporters [BR:lac02000]
 ABC transporters, prokaryotic type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Energy-coupling factor transporter
    Shared module
     LBA0319 (cbiO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran SMC_N AAA_21 AAA_29 AAA_22 AAA_15 AAA_23 TniB RsgA_GTPase
Motif
Other DBs
NCBI-GeneID: 3252591
NCBI-ProteinID: YP_193242
UniProt: Q5FM63
Position
304386..305237
Genome map
AA seq 283 aa AA seqDB search
MSKNNAVEFRHVSFTYPDTEKPVLNDINFKIRSGSWTALIGHNGSGKSTISKLTNGLLLP
DADANSKIIVSGITLNSKTVWNVREKVGIVFQNPDNQFVGATVGDDVAFGLENRGVPRNE
MIRIVNRVLSDVGMLDYINAEPANLSGGQKQRVAIAGILAVEPDIIILDESTSMLDPNGR
NQILKIIRQLMIDKNLTIISITHDIDEASLADDVIVLNDGKILAQSGPIDIFSKPELLQE
IGLDIPFVEKVILKLKETGIKVPQSIKTQDELEQYLCQLNSKK
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
gtgtcaaaaaacaacgccgttgaatttagacatgtttcatttacttatcctgatactgaa
aagcctgtcctcaatgatattaattttaaaattaggtcaggttcatggactgcattaata
ggacataatggaagtggtaaatctacaatttcaaaattgacaaatggtttgcttctacct
gatgctgatgcaaatagtaaaattattgtttcgggtataactttaaattctaaaactgta
tggaatgttagagaaaaagtaggtattgtattccaaaatccagataatcaatttgttggt
gctactgtaggtgatgatgtagcttttggattggagaataggggagtacctagaaatgaa
atgattagaattgttaatcgagttttatctgatgttggtatgttagattatataaatgca
gagccagctaatctttctggaggacagaagcaacgggtggcaatcgctggtattcttgcg
gtagaaccagatattattatcttggatgaatcgacatcgatgcttgatcctaatgggaga
aaccaaattcttaaaataattagacaattgatgatcgataaaaatttaactattatatca
attactcatgatattgatgaagcaagtttagcagacgatgtaattgttttaaatgatggg
aaaattcttgctcaaagtggtccaatagatattttcagtaaaccagaattattacaagaa
ataggtttagatataccatttgtagaaaaagtaattttaaagttaaaggaaactggaatt
aaagtgccacaaagtataaaaacacaagatgaattggagcaatatctatgtcaattaaat
tcaaaaaagtag

DBGET integrated database retrieval system