KEGG   Lactobacillus acidophilus NCFM: LBA0502Help
Entry
LBA0502           CDS       T00231                                 

Gene name
msmE
Definition
(RefSeq) sugar ABC transporter substrate-binding protein
  KO
K10120  fructooligosaccharide transport system substrate-binding protein
Organism
lac  Lactobacillus acidophilus NCFM
Brite
KEGG Orthology (KO) [BR:lac00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lac02000]
    LBA0502 (msmE)
Transporters [BR:lac02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Putative fructooligosaccharide transporter
    LBA0502 (msmE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_8 SBP_bac_1 SBP_bac_6
Motif
Other DBs
NCBI-GeneID: 3252767
NCBI-ProteinID: YP_193416
UniProt: G1UB60
Position
488692..489987
Genome map
AA seq 431 aa AA seqDB search
MKKWKLGVAAIATVAALSLTGCSNNSQSGSSNNKNVTMWVHFSNTDPEGKALQKNINDFN
KENKHGYKAKVQYIPRSGSGGGYEDKINAALNSGSLPDVLTLDAPNTAAYAHSKIIQPID
KYITNKDDILPTIIKQGTYKGKLYAAGYSESSIGFYYNKKMFKEAGIKDSEIATLQHPWT
WTQFKDICKRLKNHFHEPAINMNLNDHSEMALYSLAPFVWSAGGSITNPAGTKAVGYFNS
KQTTSAFQLIQDMVKDGYTTISPKDKGFETGKYAMMMTGTWEVQTLQNQYKNLQWGVMPY
PVSPATHKEVSPTGSWQYAMSSAAKNKKAAGALINFLMSKKCMYRSDMANTVLPARKSVS
KMMMPKVNEQMRFFIKQNQTTGHARPVLVNYPQVTRTFADTVQNVTLYKKNPNVQKVMNE
QAKVIQKYLEK
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatggaaattaggagttgcagccattgcaactgtcgcagctttgtcactaact
ggctgtagtaataatagtcaaagtggcagtagtaacaacaaaaacgttactatgtgggtt
cacttttctaatactgatccggaaggtaaagcattacaaaagaatatcaatgactttaat
aaagagaataagcatggctataaagcaaaagttcaatatattcctcgttctggttcaggt
ggcggctatgaagataagatcaatgctgctttaaactcaggaagtttaccagatgtttta
actttggatgctcctaacacagcagcttatgcacattcaaaaattattcaaccaatcgat
aagtacattactaataaagacgatattctaccaactattattaagcaaggtacttataaa
ggtaagttatatgctgctggctattcagaatcaagcatcggcttctattacaacaagaag
atgttcaaagaggctgggattaaagattcagaaattgctactttacagcatccatggact
tggactcaatttaaagatatttgtaagagacttaaaaaccacttccatgaaccagcaatt
aatatgaacttgaatgaccactcagaaatggctctttattcattagcaccatttgtatgg
tcagctggtggtagcattactaatcctgctggcacaaaggcagttggctactttaattcc
aagcaaactacttcagccttccaattaattcaagacatggtcaaagatggttacactact
atttcaccaaaggataaaggttttgaaactggcaaatatgccatgatgatgactggtact
tgggaagttcaaactttgcaaaaccaatacaagaatttgcaatggggcgtaatgccatat
cctgtatctccagctactcacaaagaggtttcaccaacaggctcatggcaatacgcaatg
tcttctgcagctaagaacaagaaggcagctggtgctttgattaacttcttaatgagtaag
aagtgtatgtaccgcagcgatatggctaacactgttttgccagcacgtaagagtgtatct
aagatgatgatgcctaaagttaatgaacaaatgagattcttcattaagcaaaaccaaact
acgggtcatgctcgtccagttttagttaactacccacaagtaactagaacatttgctgat
actgttcaaaatgtaactttgtacaagaagaatcctaatgtacaaaaggtaatgaacgaa
caagctaaagttattcaaaagtaccttgagaaatag

DBGET integrated database retrieval system