KEGG   Lactobacillus acidophilus NCFM: LBA1325Help
Entry
LBA1325           CDS       T00231                                 

Gene name
gmk
Definition
(RefSeq) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
lac  Lactobacillus acidophilus NCFM
Pathway
lac00230  Purine metabolism
lac01100  Metabolic pathways
Module
lac_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:lac00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    LBA1325 (gmk)
Enzymes [BR:lac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     LBA1325 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 MMR_HSR1 RsgA_GTPase AAA
Motif
Other DBs
NCBI-GeneID: 3252535
NCBI-ProteinID: YP_194183
UniProt: Q5FJH2
Position
complement(1303935..1304549)
Genome map
AA seq 204 aa AA seqDB search
MADKGLLLVLSGPSGVGKGTVKSAIVENKVFPFEYSVSMTTRKPRPGEVNGKDYYFVSEG
RFKEAINNGELLEYNNYVGHYYGTPLGPVKEMLHEGKDVLLEIDVNGAQKVREKMPDGVF
IFLTPPDLHTLHLRLEHRGTESEDVIRGRIKQARNEILEMEDYDYAVVNDTVANAVDHIK
AIVDAEHVSVKRVIDDYRKMVEED
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggcagataaaggtttattactcgtgctttccggtccctcaggagtcggtaaagggact
gtcaaaagcgctatagtcgaaaacaaagtctttccgtttgaatattcagtttcaatgaca
actcgtaaacctcgtccaggtgaagttaatggtaaagactattactttgttagtgaaggg
cgttttaaagaagctattaataatggtgaattattagaatataataattatgttggccat
tattacggtacgccccttggtcccgtaaaagaaatgttgcatgagggcaaggacgtttta
cttgaaattgatgttaatggtgcacaaaaagttcgtgagaagatgccggatggggtattt
atctttttaaccccacctgatcttcacacattgcatttacgtcttgaacatcgtggtact
gaatcagaagatgtaattcggggacgtattaagcaagccagaaatgaaattctggaaatg
gaagactatgactatgcagtagtaaatgatacggttgctaatgcagtagaccatattaag
gcaattgttgatgcagaacatgtcagtgttaagcgtgtaattgatgactatcgtaaaatg
gtcgaggaggattaa

DBGET integrated database retrieval system