KEGG   Lactobacillus acidophilus NCFM: LBA1719Help
Entry
LBA1719           CDS       T00231                                 

Definition
(RefSeq) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lac  Lactobacillus acidophilus NCFM
Pathway
lac00040  Pentose and glucuronate interconversions
lac00052  Galactose metabolism
lac00500  Starch and sucrose metabolism
lac00520  Amino sugar and nucleotide sugar metabolism
lac01100  Metabolic pathways
lac01130  Biosynthesis of antibiotics
Module
lac_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lac00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LBA1719
   00052 Galactose metabolism
    LBA1719
   00500 Starch and sucrose metabolism
    LBA1719
   00520 Amino sugar and nucleotide sugar metabolism
    LBA1719
Enzymes [BR:lac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     LBA1719
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD
Motif
Other DBs
NCBI-GeneID: 3251328
NCBI-ProteinID: YP_194562
UniProt: Q5FIE3
Position
complement(1754392..1755276)
Genome map
AA seq 294 aa AA seqDB search
MKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQFIVEEAKAAGIEDILIVTGKNK
RAIENHFDSNPELEQDLEATGKVKLLKLTQDITNLGINLYYTRQPHPAGLGDAIYRARSF
VGEEPFVVMLGDDLMKDKITLTKQLMNDYDKIHASTIAVMQVPHKEVSKYGVIDPEGKVD
KDLYNVKKFVEKPAVDKAPSDFAIIGRYLLTPEIFEILENQKPGRGGEIQLTDAIDTLNQ
TQRVFAHVFRGQRFDVGNKEGYLETSIQYGLRHPETRDALKKYIIDLGKKLEKE
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaagaaaagccatcattccagctgcaggtttggggacccgttttctaccagct
actaaagctatgcctaaggaaatgttaccaattgtcgataagccaacaattcaatttatt
gttgaagaagctaaagctgcaggaattgaagatattttaattgttactggtaagaataag
cgagcaattgaaaatcactttgattctaacccagaacttgaacaagacttggaagccact
ggtaaggttaagttattgaaattaactcaagatattactaacttgggaattaatttatac
tacactcgacaaccacatccagctggcttaggtgatgcaatttatcgtgcacgtagcttt
gtgggagaagaaccattcgttgttatgcttggtgatgacttaatgaaggacaaaattaca
ttaactaagcaattgatgaatgattacgataagattcatgcatcaacaattgctgttatg
caggttccgcataaggaagtttccaagtacggtgtgattgatcctgaaggcaaggtggat
aaagatctttacaatgtaaagaaatttgttgaaaagcctgccgttgacaaggcaccaagt
gattttgcaattattggacgttacttactcacaccggaaatttttgaaattcttgagaat
caaaagccaggtcgcggtggtgaaattcaattaactgatgccatcgatactttgaaccag
actcaacgagtatttgcacatgtctttagaggtcaacgttttgatgtaggtaacaaggaa
ggctaccttgaaacctcaattcaatatggtttaagacaccctgaaactcgcgatgctttg
aagaaatatattatcgacttaggcaagaagcttgaaaaggaataa

DBGET integrated database retrieval system