KEGG   Lactobacillus acidophilus NCFM: LBA1926Help
Entry
LBA1926           CDS       T00231                                 

Gene name
dltA
Definition
(RefSeq) D-alanine--poly(phosphoribitol) ligase subunit 1
  KO
K03367  D-alanine--poly(phosphoribitol) ligase subunit 1 [EC:6.1.1.13]
Organism
lac  Lactobacillus acidophilus NCFM
Pathway
lac00473  D-Alanine metabolism
lac01100  Metabolic pathways
lac01503  Cationic antimicrobial peptide (CAMP) resistance
lac02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lac00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    LBA1926 (dltA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LBA1926 (dltA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    LBA1926 (dltA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:lac01504]
    LBA1926 (dltA)
Enzymes [BR:lac01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.13  D-alanine---poly(phosphoribitol) ligase
     LBA1926 (dltA)
Antimicrobial resistance genes [BR:lac01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, dltABCD operon [MD:M00725]
    LBA1926 (dltA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 3251316
NCBI-ProteinID: YP_194754
UniProt: Q5FHV1
Position
complement(1935919..1937433)
Genome map
AA seq 504 aa AA seqDB search
MIQDVIKRIDEIAENEPDRVVYDYLGETNTYGDLKKRSNAWAHKIASMDIPEHAPIMIWG
GQTFEMIASFLGCVKSGHAYIPIASYSNAERLTMIQDVSKSPMVLEIDPLPDVNLDGIKV
LKANEVEDGDFTVDESNFVEGDENYYIIFTSGTTGKPKGVQISHDNLLSFVNWELSDFNL
PEHPSFLAQAPYSFDLSVMSLYPALVSAGKLVVLPHDVTQNFGQLFQTLPKMQFNVWVST
PSFAQMCFLDKTFDAEHHPDLTHFLFCGEELPHSEADMLKKKFPESHIFNTYGPTETTVA
VTQVEITDEILEKYDRLPIGRVKEDTKITIDTSKGDKPGEGEIIISGPSVSKGYMNNPEK
TEAAFFQNEGDKYRSYRSGDAGFFDGDMLFYRGRIDFQIKFNGYRIELEEINFYLSKNEF
VRYGVAAPKYNKDHTVKQIVAEIELKHGVRRKYSDAQLTKLIREDLAKNVMPYMIPQRYV
YQDTLPISQNGKVDIKAVIKEVNK
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgattcaagatgttattaagagaattgacgagatagctgaaaatgaaccagatcgtgta
gtttacgattatctcggtgaaaccaatacatatggtgaccttaagaagcgttcaaacgct
tgggcacacaagattgctagtatggatatcccagaacatgcaccaatcatgatctggggt
ggtcaaacatttgaaatgattgctagtttcttaggttgtgttaaatcaggccacgcatat
attccaattgcaagttattcaaatgctgaacgtttaacaatgattcaagatgtttcaaaa
tcacctatggttttggaaattgatccattgccagacgttaatttagacggcatcaaggta
cttaaagctaatgaagttgaagatggcgactttacagttgatgaaagtaatttcgttgaa
ggcgacgaaaattactatattatctttacttcaggtactactggtaagccaaagggtgta
caaatcagtcatgataatttgttgagttttgtaaactgggaattatcagattttaatttg
ccagaacacccaagctttttggcacaagctccatactcatttgacttgtcagttatgagc
ctttatcctgcacttgtttcagcaggaaagcttgttgttttaccacatgatgttacgcaa
aactttggtcaattgttccaaactttaccaaaaatgcaatttaatgtttgggtatcaact
ccatcatttgcacaaatgtgtttcttagataaaacctttgatgcagaacatcatccagac
ttaactcacttcttattctgtggtgaagaattaccacatagtgaagctgatatgcttaag
aagaagttcccagaaagtcatatttttaatacttacggtcctactgaaactacagttgct
gtgactcaagtagagatcactgatgaaatacttgaaaagtatgatcgtctaccaattggt
agagtaaaagaagacactaagattactattgatacttcaaagggagataagcctggcgaa
ggtgaaatcattatcagtggtcctagcgtttcaaaagggtacatgaataaccctgaaaag
accgaagctgctttcttccaaaatgagggcgacaagtatcgcagctaccgtagtggagat
gctggattctttgatggtgatatgctattttatcgcggtagaatcgacttccaaatcaag
ttcaatggttacagaatcgaacttgaagaaattaatttctacttgtcaaagaatgaattt
gtacgttatggtgtcgcagcacctaaatacaataaagatcatactgtaaagcaaattgtt
gctgaaatcgaattgaagcatggcgttcgtcgtaagtattctgatgcacaacttactaag
ttgattcgtgaagacttagctaagaacgtgatgccttacatgattccacagcgttatgtt
taccaagatacattaccaatttctcaaaacggtaaggtggatattaaggcagttattaag
gaggttaataagtag

DBGET integrated database retrieval system