KEGG   Lactobacillus acidipiscis: LAC1533_0064Help
Entry
LAC1533_0064      CDS       T05349                                 

Definition
(GenBank) Threonine dehydrogenase and related Zn-dependent dehydrogenases
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
laca  Lactobacillus acidipiscis
Pathway
laca00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:laca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    LAC1533_0064
Enzymes [BR:laca01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     LAC1533_0064
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     LAC1533_0064
    1.1.1.-  
     LAC1533_0064
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C 2-Hacid_dh_C Pyr_redox_2 AlaDh_PNT_C 3HCDH_N Rho_N
Motif
Other DBs
NCBI-ProteinID: SFV39484
UniProt: A0A1K1KKS7
Position
I:70338..71402
Genome map
AA seq 354 aa AA seqDB search
MKAARIYGKQDIRIEDVEIPEPKDDQVQIKVKFVGICGSDIHMYSEGLSLPYEKNPLTGK
TVPIIEGHEFSGQVVKVGQDVHEVQVGDRIAVEPILACGHCRNCMKGLYNYCLHAVGPDG
SGNFIGVSGDGGMAEYANVEAKFAHKLPDEMGFDLGALVEPTSVAYEGIKRSGLIEGQTV
AVMGAGPIGLCTAILAKIAGATKVYISDVSDVRLAKAKEVGIENTLNPTKDDVVEKIHED
LPDGVDIAFECAGVQATFDTATQITTATGLIQVDALFGKSIELDINDAIMKGHNIHTTLG
YENAFPTVINIINSNQEIFQKMITKKISLDDTVEGIKSLQSDKSQVKVMISPEM
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcaagaatttatggcaaacaagatattcggatcgaagacgttgagatccct
gaacctaaggatgatcaagttcaaatcaaggtcaagtttgtagggatctgtggtagtgat
attcatatgtattcagagggcctttccttaccatatgagaagaatcctttgaccggtaaa
actgttccgatcattgaaggacatgaattttctggtcaagtggttaaagttggtcaggat
gttcatgaggttcaagttggtgatcgaatcgcagtcgaacccatcttagcttgtggacat
tgtcggaattgtatgaaaggtttgtataattattgtttgcacgctgttggtccagatggc
agtggaaactttatcggtgtttcaggcgatggcgggatggcagaatatgccaacgttgag
gccaagtttgcacataaattaccagatgaaatgggctttgacctaggtgctttagttgaa
ccaacttctgtagcctatgaaggtatcaagcgtagtggtttgatcgaaggccaaaccgtc
gcagttatgggtgccggcccaatcggcttatgtacagctattttggctaagatcgctggg
gcaacaaaagtatatatttcagatgtttctgatgttcgtctcgctaaagcaaaagaagtg
ggcatcgaaaacactttgaatccaactaaagatgatgttgttgaaaagatccatgaagat
ctgccagatggtgtggacattgcatttgaatgtgcaggggttcaagcaacatttgataca
gctacacaaattacaacagccactggcttgattcaagttgatgctttgtttggcaaatcc
atcgagcttgatattaatgacgcaattatgaaaggccacaatatccacactacattaggt
tacgaaaatgcattcccaacagttattaatattatcaatagtaaccaagagattttccag
aagatgatcactaagaagatctcattagacgacactgttgaagggatcaaatcattgcag
agtgataaatcacaagttaaagttatgatttcaccagaaatgtaa

DBGET integrated database retrieval system