KEGG   Lactobacillus acidipiscis: LAC1533_0324Help
Entry
LAC1533_0324      CDS       T05349                                 

Definition
(GenBank) D-3-phosphoglycerate dehydrogenase
  KO
K00018  glycerate dehydrogenase [EC:1.1.1.29]
Organism
laca  Lactobacillus acidipiscis
Pathway
laca00260  Glycine, serine and threonine metabolism
laca00630  Glyoxylate and dicarboxylate metabolism
laca00680  Methane metabolism
laca01100  Metabolic pathways
laca01110  Biosynthesis of secondary metabolites
laca01120  Microbial metabolism in diverse environments
laca01130  Biosynthesis of antibiotics
laca01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:laca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    LAC1533_0324
  09102 Energy metabolism
   00680 Methane metabolism
    LAC1533_0324
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LAC1533_0324
Enzymes [BR:laca01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.29  glycerate dehydrogenase
     LAC1533_0324
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh XdhC_C NAD_binding_2 AdoHcyase_NAD HXXSHH
Motif
Other DBs
NCBI-ProteinID: SFV39744
UniProt: A0A0R2JLN3
Position
I:353415..354380
Genome map
AA seq 321 aa AA seqDB search
MKIVVLDGYALNPGDIDWAPLQEIGECEIYDRTSFTDKKEILKRIGDARIVLTNKTPIDE
EIINSAPNIGYIGVLATGYNVIDIAAATKAGVTVTNIPTYGTEAVAQFTFALLLEITSQV
GLHDRLVHNGKWSSNPDFSFFAKPLTELQGKVLGLVGFGRIAQKVAEIGHAFGMTVIFYN
HRPKKVKQDWQKQVSLDTLLKNSDVVSLHVPQTPDTTEMINDSSLKKMKDSAILLNTARG
GLINEKDVADALNNGQIAAAAVDVAQCEPLNADSPLLDADNCYITPHIAWAPQETRVRLL
GIAVDNLTEFLAGRKKNVVDK
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaagattgttgttttagatggatatgcgttaaatccaggtgatattgattgggcaccg
ttacaagaaatcggtgaatgcgagatttatgatcggacttcgtttactgataagaaagaa
attttaaaacggatcggtgatgcacggatcgttttgacaaataaaacccctatagatgaa
gaaattattaatagtgcacctaacataggatatattggagttttagctactggatataat
gtgatcgatatagctgcggcaaccaaggcaggggtcacagttacgaatattccgacttac
ggaactgaagctgtggcacaatttacttttgcgctgttattggaaatcactagtcaagtt
ggtttacatgaccggttagttcataatggaaaatggtcaagtaatcctgactttagtttc
tttgctaaacctttgacagagttgcaaggaaaggtacttggactagtaggctttggcagg
atagcccaaaaggttgctgagattggacatgcatttggaatgactgtgattttttacaat
catcgtcctaaaaaagttaaacaagattggcaaaagcaagtcagtttggatactctgctg
aaaaactccgatgttgtcagcttgcatgtcccgcaaacaccagacactacagaaatgata
aatgattcttccttaaagaaaatgaaagattcggctatactgctaaatactgccaggggt
gggctgatcaacgagaaagatgtcgctgatgcactgaataatgggcagattgctgctgca
gcagttgacgttgcacaatgtgaaccgcttaatgcggatagtccattgttagatgcagat
aattgttatattactccccatattgcttgggcaccacaagaaacaagagtccgtctgtta
ggtatcgcggtcgataatttgaccgaatttttggcaggtcgaaagaaaaatgttgttgat
aagtaa

DBGET integrated database retrieval system