KEGG   Lactobacillus acidipiscis: LAC1533_0349Help
Entry
LAC1533_0349      CDS       T05349                                 

Definition
(GenBank) Aldehyde dehydrogenase A
  KO
K07248  lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21]
Organism
laca  Lactobacillus acidipiscis
Pathway
laca00620  Pyruvate metabolism
laca00630  Glyoxylate and dicarboxylate metabolism
laca01100  Metabolic pathways
laca01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:laca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LAC1533_0349
   00630 Glyoxylate and dicarboxylate metabolism
    LAC1533_0349
Enzymes [BR:laca01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.21  glycolaldehyde dehydrogenase
     LAC1533_0349
    1.2.1.22  lactaldehyde dehydrogenase
     LAC1533_0349
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC DUF1487 NB-ARC
Motif
Other DBs
NCBI-ProteinID: SFV39769
UniProt: A0A0R2K3F6
Position
I:370278..371375
Genome map
AA seq 365 aa AA seqDB search
MTGLAQSNKGEVLQNQVDHETIMLIKKPIGVTAGIIPWNAPIFILMRKMIPALVTGCSII
VKPSGETPLGTFKIAELLQKTDIPAGLVQIISGPGSSIGNLLAKNQQINLISITGSTGAG
KSVMEAAAANVKKVNLELGGKAPAIVTNKADIDKAVKYIVMARIKNSGQVCTCPERIYVQ
GEVYDEFVKKVTDTMSKIVTGDPTSPNTDMGPIINKKQLDSIEQKVQDAVAAGAKVLTGG
HIIESEGNFYEPTVIVNVDDDSQIMKDEIFGPVLPIAKFATIDEAIDRANDSPYGLSSYV
YTDDLKESMEFTNRLNIGEVYVNCEAEEALTGYHAGWRQSGLGGADGQHGFEEYLNTTVS
YLRYE
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgacggggctggcccaatctaataagggtgaggttttacaaaaccaagttgatcatgaa
actattatgctgatcaaaaagcctatcggagtaacggctggcatcattccttggaatgca
ccaatttttattctaatgcgtaaaatgatccctgctttagtaactggttgttcaattatt
gttaaacctagtggtgagaccccgctaggaacctttaaaatcgcagaattactgcaaaaa
acagatattcctgctggtctagttcaaattatcagtggcccaggatcctcgattggaaat
ttacttgctaaaaatcaacaaataaatttaatttctattacgggaagtacaggtgccggt
aagtcagttatggaagctgcggcagctaatgtaaagaaggtcaacttggaattaggtggt
aaagctcctgcaattgtcactaataaagctgatattgataaggctgtgaagtatattgtg
atggctcggatcaaaaacagtggtcaggtctgcacttgcccagaaaggatctatgtacaa
ggcgaagtttatgatgaatttgtcaagaaagtcacagatactatgagcaaaatcgttacg
ggggatccaacttcacctaacactgatatgggaccgatcattaataagaaacaattagat
tctattgaacaaaaagttcaggatgccgttgctgccggcgctaaagttctaactggcggt
catattattgaaagtgagggcaatttttatgaaccgactgtgatcgttaatgtcgatgat
gactctcaaatcatgaaagacgaaatttttgggccggttttgccaatagctaagtttgct
accattgatgaagccatcgatagggctaatgactccccatatggtctttcttcatatgta
tacactgatgacttaaaagaatccatggagtttactaatcgtttgaacattggtgaagtt
tacgttaactgtgaagctgaagaagctctcactggctatcatgctggttggcgtcaatct
ggcctaggcggtgccgatggtcaacatggatttgaagaatatttgaatacgactgttagt
tatctgcgttacgaataa

DBGET integrated database retrieval system