KEGG   Lactobacillus acidipiscis: LAC1533_2211Help
Entry
LAC1533_2211      CDS       T05349                                 

Definition
(GenBank) Mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
laca  Lactobacillus acidipiscis
Pathway
laca00051  Fructose and mannose metabolism
laca01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:laca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    LAC1533_2211
Enzymes [BR:laca01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     LAC1533_2211
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh UPF0052
Motif
Other DBs
NCBI-ProteinID: SFV41636
UniProt: A0A1K1KRZ9
Position
I:complement(2403124..2404281)
Genome map
AA seq 385 aa AA seqDB search
MKAVHFGAGNIGRGFIGETLAANDFSIDFVDVNDTIISALNSRHEYDIELAAPSQEKIHV
ENVDGINNGKEPEKVVAAIAETDLVTTAIGPKILQFIAPLIAEGLVARKKQGNTQKVDVI
ACENMIGGSAHLKDEVYKALADEDQAFVNEYVGFPNAAVDRIVPLQKHDDPLMVSVEPFK
EWVVDESQMANPNLKLEGVSYAPDLEPYIERKLFSVNTGHATVAYTGKTLGYDTIGDAIK
DERVLNQLKGVLKETGDLLIAKWNFKREDHEAYQKKIINRFENPYISDTIARVGRTPIRK
LGFDERFIRPIREAKEHGLGYEKLLETVGKIYQFNVPEDDESVKLQQMLQDKFAEVVTST
TDLKDQELVSEIAGKMSEEFTATHK
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagttcattttggagcaggtaacattggtcgcggttttatcggagaaacatta
gccgcaaatgatttttcaattgattttgtagacgttaatgatacgatcatttccgcactg
aattcacggcatgaatatgacatcgagctggctgcacctagccaagaaaagatccatgtt
gaaaatgtcgatggtatcaataatggcaaagaacccgaaaaggttgtggcagccattgcg
gaaactgacttggttacaactgcgatcggtcctaaaatcttacaatttatcgcacctttg
atcgcagaaggtttggttgctcgtaagaaacaaggcaacacacaaaaggttgatgtgatc
gcctgtgaaaacatgatcggtggctcagctcatctaaaggatgaagtatacaaggctttg
gctgatgaagatcaagcgtttgttaatgaatatgttggttttcctaatgctgcagttgat
cggatcgtaccattacagaaacatgatgatcccttgatggtttctgttgaaccattcaag
gaatgggtcgtcgatgaatcacaaatggctaaccctaatttaaagctggaaggcgtttct
tatgctccagacttggaaccatatattgaacgtaagttattctcagttaatactggtcat
gctacagtagcctatactggtaaaacgttaggctatgatacgatcggtgacgctattaag
gatgaacgtgttttgaatcagctgaagggtgtcttgaaagagactggtgatttgttgatt
gctaagtggaacttcaagcgtgaagaccatgaggcttatcaaaagaagatcatcaatcgt
tttgaaaatccttatatctctgacacaattgctcgtgttggtcggacaccgatccgcaaa
cttggctttgatgagcgttttattcggccgattcgcgaagcaaaagagcatggtttgggc
tatgaaaaactgttagaaacagttggtaagatttatcaattcaatgttccagaagacgat
gagagcgtcaaattgcaacaaatgctgcaagataaatttgctgaagtagttacttctacg
actgatttgaaagatcaggaattagtaagtgaaattgctggtaaaatgtcagaagaattt
actgcaacgcataaataa

DBGET integrated database retrieval system