KEGG   Lactococcus sp. 1JSPR-7: D7I46_05705Help
Entry
D7I46_05705       CDS       T05686                                 

Definition
(GenBank) hydroxymethylglutaryl-CoA reductase, degradative
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
lact  Lactococcus sp. 1JSPR-7
Pathway
lact00900  Terpenoid backbone biosynthesis
lact01110  Biosynthesis of secondary metabolites
lact01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lact00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    D7I46_05705
Enzymes [BR:lact01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     D7I46_05705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red
Motif
Other DBs
NCBI-ProteinID: AYG00631
UniProt: A0A387BQ50
Position
complement(1208606..1209838)
Genome map
AA seq 410 aa AA seqDB search
MEKKFYQMTPEERRQTLDLPEKTRAVLRQMALDEAIANNLIENQISEFELPMGLAQNFVI
NDKKYLIPFVTEEPSVVAAASNGAKMAGKFTAKITERLMRGQIVFYDVQNATKLTDRISV
STDEILLVARTAYPSIVERGGGLREISTRIFDENFLSVDFKIDVRDAMGANIVNSILEGI
AERFRQWFPEEKILFSILSNFATESLVKVSCEIPVKKLSKTDNGAEVADKIMAASRFAKL
DPYRAATHNKGIMNGINAVVLATGNDTRAIAAGIHAFASLDGQYRALGTWRVSGDTLLGE
LELPLPVATVGGGVKVLPKAQAAMEILQITEAQELAKVIAAVGLAQNLAALRALVSEGIQ
QGHMGLQARALALSVGAKAEEVAQLSELLRQSKLMNQATAEKLLTALRTH
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagaaattctatcagatgacgccagaagaacgccgtcagacgcttgatttacct
gagaaaacgcgggctgttttgcgtcaaatggcactcgatgaagccatcgcaaataatttg
attgaaaaccaaatctcagagtttgagctgccaatgggactcgcccaaaattttgtcatt
aatgacaaaaaatatttgattccttttgtgacagaagagccatcagttgttgctgcagca
agcaacggtgccaaaatggctggcaaatttactgcaaagattacggaacggttaatgcgt
gggcaaattgtcttttatgacgtacaaaatgccacgaaacttactgacagaatttctgtc
agcactgacgaaatcttgttagtagcacgaacagcttatccctctattgtcgaaagaggt
ggaggcttacgagaaatttctactcgaatttttgacgaaaattttttgtcagtagatttt
aagattgatgtcagagatgcgatgggggcaaacattgtcaattcaatattggagggcata
gcagagcgttttcgtcagtggtttcctgaggaaaaaattttgttcagcattctgtcaaat
tttgcgaccgaatctctggtaaaagtaagctgtgaaattccggtcaaaaagctgtcaaaa
actgacaacggcgcagaagttgctgacaaaatcatggcagcttcgcgttttgcaaaactt
gacccttatcgtgccgcgacgcacaataaaggaatcatgaacggtatcaatgcggtcgtg
cttgcgactggaaatgacacgcgcgccatagcagctggcattcacgcttttgcgagtctc
gatggacaataccgcgctcttggaacttggcgagtttcaggagatacgcttttgggcgag
ctagagttgccgttacccgttgcaacagttggcggaggcgtcaaagttttacctaaagcg
caagcagcaatggaaattttgcaaattacagaagctcaggagttggcgaaagtgattgct
gctgttggcttggcacaaaaccttgcagccttgcgtgcgcttgtttctgagggcatccag
cagggacatatgggcttacaagctcgcgcgctggcgctttcggtcggtgcaaaagctgaa
gaagttgctcaactcagcgaacttctccgccaatcaaaactaatgaatcaagcgacagca
gaaaaattactgacagcactcagaactcactga

DBGET integrated database retrieval system