KEGG   Lachnoclostridium sp. YL32: A4V08_09010
Entry
A4V08_09010       CDS       T04430                                 

Definition
(GenBank) xanthine dehydrogenase molybdenum-binding subunit XdhA
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
lacy  Lachnoclostridium sp. YL32
Pathway
lacy00230  Purine metabolism
lacy01100  Metabolic pathways
lacy01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lacy00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    A4V08_09010
Enzymes [BR:lacy01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     A4V08_09010
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: ANU45933
UniProt: A0A1C7G103
Position
complement(2023225..2025513)
AA seq 762 aa
MGIGKNMTRVDAFDKVTGSAKYTADLEPQGLLAAKVIRSTIANGVVKSFDLEEALKVAGV
VKIVTCFDVPDIQFPTPGHPWSVETAHQDIADRKLLNTRVRVYGDDIAAVIAEDDIAAAR
AARLVKVEYEEYAPLLTVEDAMAEDAPRLHDEKPGNVIAHSSFVVGEGTYGDAVKEEGLV
EIEKDYRTQSVQHCHIETPISFAYMEKGRITVTTSTQIPHIVRRVISQALGLPMGRIRVI
KPYIGGGFGNKQDVLYEPLNAFLTTQVGGRGVRMEISREETLGCTRVRHAIEFKVKAAAR
KDGTLVARKLEAYSNQGGYASHAHAIVANSSNEFKQIYRDEKVLESDAWTVYTNLATGGA
MRGYGIPQAAFAAECMADDLALALHMDPLEFRKKNCMRPGYVDPHTHVKCNTYGLAECME
KGREFIRWDEKRREYENQTGPVRKGIGMAIFCYKTGVYPISLETASCRMILNQDGSMQLQ
MGATEIGQGADTVFTQMAAEVTGITEDKVNVLSTQDTDVSPFDTGAYASRQTYVSGMAVK
KTGAIFKEKILDYAAYMLEKPQDTLDVRDNHIVDKETGKQLLPMEDLAATAFYSLDRSIH
ITAEATSHCKTNTFATGVCFAEVEVDMPLGKVKVTNIVNVHDSGKLINPKLAAAQVHGGM
SMGLGYGLSEELLFDAKGRPLNDNLLDYKLPTAMDTPDLNALFVELDDPTGPFGNKALGE
PPAIPVAPAVRNAVLNATGVAVDSLPMDPQKMVKHFKEAGLI
NT seq 2289 nt   +upstreamnt  +downstreamnt
atgggaattggtaaaaacatgacccgcgttgacgcatttgacaaagtcacaggcagtgcc
aagtatacagccgatttagagccccagggacttctggcggcaaaggtaatacgcagcacc
atcgccaacggcgtggtaaaaagctttgatttggaagaagcactgaaggtggcgggggta
gtgaagattgtcacgtgcttcgatgtgccggacatccagttcccaacacccggccatcca
tggtccgtggaaacggcccatcaggatattgcggacaggaaacttctcaataccagggta
cgggtctatggagatgatatagcagccgttatagcggaggatgatatagcggcagccagg
gcggccaggcttgtgaaggtggagtatgaggagtatgcccccctgctgaccgtggaggat
gccatggcagaggacgccccccggcttcacgatgaaaaaccgggaaatgtcatcgcccat
tcctcctttgtggtgggtgaagggacttacggggacgcggtgaaagaggaggggctggtg
gagatagaaaaggactaccggacccagagcgtgcagcactgccatatagagacgcccatc
tcctttgcctatatggaaaagggaagaatcaccgtcactacatccacgcagataccccat
attgtgcgccgcgtcatcagccaggcgctgggactgcccatgggccgtatccgcgtcatc
aagccttacatcggcggaggtttcggcaacaagcaggatgtgctctatgagcccttaaat
gctttccttaccacccaggtgggaggaaggggcgtgaggatggagatatccagagaagag
actctgggctgtaccagggtgcgccacgccattgagtttaaggtaaaggcagccgccagg
aaggacggaacactggttgccaggaagctggaggcctattccaaccagggcggatatgcg
tcccatgcccatgccatcgtagctaactcctccaatgagttcaagcagatttacagggat
gagaaagtgctggagtcagatgcctggaccgtgtacaccaacctggccacaggaggagcc
atgaggggatacggaattccccaggccgcgtttgcggcggaatgcatggcagacgacctg
gccctggcccttcacatggacccattggaatttaggaaaaagaactgcatgaggccggga
tacgttgatccccacacccatgtaaaatgcaatacatacggcctggcggaatgtatggaa
aagggccgtgaatttatccgctgggacgaaaagcgcagggaatatgaaaaccagacagga
cccgtgcgaaagggaatcggaatggctatcttctgctataagacaggcgtataccccata
tccctggaaacagcgtcctgccgtatgatacttaaccaggacggttccatgcagcttcag
atgggggcaacggaaattggccagggcgccgacaccgtgttcacccagatggcggcagag
gtgaccggaatcacggaagacaaggtaaatgtgctgtccacccaggacacggacgtaagt
ccctttgacacaggtgcatacgcttccagacagacctatgtcagcggaatggcagtgaag
aaaaccggcgctatatttaaggaaaagatactggattatgctgcttatatgctggagaag
ccacaggataccctggatgtaagggataaccacatcgtggataaggagaccggaaagcag
ctgcttcccatggaggatctggctgccacggcattttacagcctggaccgctccatacat
atcacggcagaggccaccagccattgcaagaccaatacatttgccaccggtgtctgcttc
gcggaggtagaggtggatatgcctttgggcaaggtgaaggtgactaatatcgtcaatgta
catgacagcggaaaactgattaaccccaagctggccgccgcccaggtacacggcggcatg
agcatgggactgggctacggcctcagcgaggagctgctctttgacgcgaaggggagaccg
ttaaacgataatttgctggactacaagcttccaacagccatggataccccggacttaaac
gcactttttgtggagttggatgaccccacaggcccctttggaaataaggcccttggggag
ccgccggccataccggttgccccggcagtgcgcaacgcggtgcttaacgccacaggtgtt
gccgtggacagtctgcccatggatccccagaagatggtgaagcatttcaaggaagcagga
ttaatatag

DBGET integrated database retrieval system