KEGG   Lachnoclostridium sp. YL32: A4V08_12180Help
Entry
A4V08_12180       CDS       T04430                                 

Definition
(GenBank) oxaloacetate decarboxylase
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
lacy  Lachnoclostridium sp. YL32
Pathway
lacy00620  Pyruvate metabolism
lacy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lacy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A4V08_12180
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lacy02000]
    A4V08_12180
Enzymes [BR:lacy01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     A4V08_12180
Transporters [BR:lacy02000]
 Other transporters
  Primary active transporters [TC:3]
   A4V08_12180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like
Motif
Other DBs
NCBI-ProteinID: ANU46439
UniProt: A0A1C7G2Q7
Position
complement(2693470..2694882)
Genome map
AA seq 470 aa AA seqDB search
MAEIEKRPVKIVETVLRDAHQSLLATRMSTEQMLPIIDKMDKVGYHAVECWGGATFDSCL
RFLKEDPWERLRKLRDGFKNTKLQMLFRGQNILGYNHYADDVVEYFVQKSISNGIDIIRI
FDCLNDIRNLETAVKATNKEKGHAQIALCYTLGDAYTLDYWKDIARRIEDMGADSLCIKD
MAGLLTPYAASELVQALKEGTSLPIDLHTHYTSGVASMTYLKAVEAGCEIIDCAMSPLAL
GTSQPATEVMVETFRGTPYDTGYDQSLLAEIADHFQPIREQALKSGLLNPKVLGVNIKTL
QYQVPGGMLSNLVSQLKEAGQEDKYREVLEEIPRVRKDFGEPPLVTPSSQIVGTQAVMNV
IMGERYKMVPKESKKIMLGEFGQTVKPFNPEVQKKIIGDETPITCRPADLIAPQLPQFEK
ECAQWKQQDEDVLSYALFPAVAKDFFEYRAAQQTKVDSSAADKDSKAYPV
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggcagagatagaaaagaggccagtgaagattgtggaaaccgtccttcgtgacgcccac
cagtctttgctcgcaaccagaatgtccacagagcagatgctgcccattatcgataagatg
gacaaggtaggctaccatgcggttgagtgctggggcggagctacctttgattcctgtctc
cgtttcctgaaggaagatccatgggagagactgaggaaactgagagacggatttaagaat
accaagctgcagatgctgttccgcggacagaacatcctgggatataaccactatgcagac
gatgtagtggagtattttgtacagaagtccatttccaacggtattgatatcatccgtatc
tttgactgtctgaatgatatccgcaacctggagacagctgtgaaggctaccaacaaagaa
aaaggacatgctcagattgcgctgtgctatactttgggcgatgcctatacactggattac
tggaaggatattgccaggagaattgaggacatgggcgctgactccctgtgtatcaaggat
atggcaggcctgctgactccatatgcggcatcagagctggtacaggcgctgaaggaagga
acaagccttcctatcgacctgcatacccactacacatcaggtgttgcttctatgacctac
ttaaaggcagtagaggcaggatgcgaaatcatcgactgcgccatgtcacctctggctctg
ggaaccagccagccggccactgaggttatggtggagaccttccgcggcaccccctatgac
actggctatgaccagtcactgctggctgagattgcagaccatttccagcccatacgtgag
caggcccttaagagcggccttctgaacccgaaggttctgggcgttaatatcaagaccctt
cagtatcaggtgccgggcggtatgctttccaacctggtaagccagttaaaagaggccgga
caggaagacaagtaccgcgaagttctggaggagattccgagagtgcgcaaggacttcggt
gagcctccgttagttaccccgtcatcccagattgtgggtacacaggctgttatgaacgtt
attatgggcgagcgctataagatggttccaaaggaatccaagaaaatcatgcttggcgaa
ttcggccagacagttaagccctttaatccggaagtgcagaaaaagattatcggcgacgag
acaccgattacctgccgtcccgccgacctgattgctccgcagcttcctcagtttgagaag
gaatgcgcacagtggaagcagcaggatgaggatgttctcagctatgcgctgttcccggca
gtggccaaggatttcttcgagtacagggctgcccagcagactaaggttgacagcagcgcg
gccgacaaggacagcaaggcttatcctgtttaa

DBGET integrated database retrieval system