KEGG   Lachnoclostridium sp. YL32: A4V08_22110Help
Entry
A4V08_22110       CDS       T04430                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
lacy  Lachnoclostridium sp. YL32
Pathway
lacy03010  Ribosome
Brite
KEGG Orthology (KO) [BR:lacy00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    A4V08_22110
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:lacy03011]
    A4V08_22110
Ribosome [BR:lacy03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    A4V08_22110
  Bacteria
    A4V08_22110
  Archaea
    A4V08_22110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 DUF2423 4F5
Motif
Other DBs
NCBI-ProteinID: ANU48097
UniProt: A0A1C7G9G3
Position
4687325..4687711
Genome map
AA seq 128 aa AA seqDB search
MAKGHRSQVKRERNAQKDTRPSATLSYARVSVQKACFVLDAIRGKDLQTALGIVTYNPRY
ASSLIKKLLESAAANAENNNGMDPAKLYVEECYANQGPTMKRVRPRAQGRAYRIEKRMSH
ITVVLNER
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaggacatagatcccaagtcaagagagaaagaaatgcccagaaggacacaaga
ccaagcgcaacactgtcttacgcgagagtgtctgtccagaaggcttgctttgtattagat
gccatcagaggcaaagatttacagaccgcacttggtattgtaacttacaatcccagatac
gcttccagcttaatcaagaagttactggaatcagctgcagcaaatgctgagaacaataac
ggaatggacccagcgaaactttatgttgaagagtgctacgctaaccagggtccgaccatg
aagagagtcagaccgagagctcagggacgtgcttacaggatcgagaagagaatgagccac
atcactgttgttctgaatgagagatag

DBGET integrated database retrieval system