KEGG   Lachnoclostridium sp. YL32: A4V08_26245Help
Entry
A4V08_26245       CDS       T04430                                 

Definition
(GenBank) bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
lacy  Lachnoclostridium sp. YL32
Pathway
lacy00740  Riboflavin metabolism
lacy00790  Folate biosynthesis
lacy01100  Metabolic pathways
lacy01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lacy00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    A4V08_26245
   00790 Folate biosynthesis
    A4V08_26245
Enzymes [BR:lacy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     A4V08_26245
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     A4V08_26245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2 Fucose_iso_C
Motif
Other DBs
NCBI-ProteinID: ANU50628
UniProt: A0A1C7GDP3
Position
complement(5523417..5524616)
Genome map
AA seq 399 aa AA seqDB search
MEGFNTIEEVLDDLRQGKIVLVTDDESRENEGDFICAAQYATTENVNFMAVHGRGLICMP
MSTQLCTRLKFPQMVSDNSDNHETAFTVSIDHISTSTGISAAERGVTARQCVNALSRPED
FRRPGHMFPLAARKNGVLERNGHTEATVDLMRLAGLSECGLCCEIMREDGTMMRMPQLLQ
YAGQWNMKITTIKALQDYRKQHDTLVECAAVTHMPTRYGTFKAYGYRNLLNGEHHVALVK
GEIGDGRDLLCRVHSECLTGDAFGSLRCDCGQQLAAAMARIEQEGRGVLLYMRQEGRGIG
LLNKLRAYELQDQGMDTLEANLALGFPGDLREYFIGAQILRDLGARTLRLLTNNPDKVYQ
LSGFGLDIKERVPIQMTPTDHDLFYLRTKEQRMGHLTHY
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggaaggattcaacaccatagaagaagtactggacgacctgcgccagggaaaaatcgta
ctggtgacagacgacgaaagcagggaaaatgagggcgattttatctgcgccgcccaatat
gccaccacggaaaacgtgaattttatggcagtgcacggcagaggtcttatctgtatgccc
atgagcacacaactgtgcacaaggcttaagttcccgcagatggtatccgacaattccgac
aaccacgagacagcctttaccgtatccattgaccacataagcacctccaccggcatttcc
gcggccgaacggggcgtaacggccagacagtgtgtcaatgccctgtcccggcctgaggat
ttccgtcgtcccggccacatgtttccgctggcagccagaaaaaatggggtgctggaacgg
aacggccataccgaagccaccgttgacctgatgcgtctggccggtctcagtgaatgcgga
ctttgctgtgaaatcatgagggaggacggaaccatgatgcggatgccccagcttcttcaa
tacgccggacaatggaacatgaaaatcaccaccatcaaggccctccaggactaccgcaaa
cagcacgatacgctggtggaatgcgctgccgtcacccatatgccaacccgttacggcacc
tttaaggcttacggctacaggaacctgctgaacggagaacatcatgtggccttagtaaaa
ggagagattggggacggccgtgacttattatgccgggtccactcggaatgcctgacaggc
gacgcctttggctccctgcgctgcgactgcggacagcagcttgccgcggccatggcccgg
attgagcaggaaggcaggggagttctcctctacatgcgccaggaaggcagaggcatcggg
cttctcaataagctgcgggcttacgaactgcaggatcagggcatggataccctggaagcc
aatctggctctgggttttcccggggatttgagggaatatttcataggcgcccagatatta
agggacctaggtgccaggaccctgcggcttctgaccaataacccggataaggtataccag
ctctccggctttggcctggatatcaaagaacgggtgccgatccagatgacgcccacagac
catgatctgttctatttaaggacaaaggaacagcgcatgggacatttgacacattattaa

DBGET integrated database retrieval system