KEGG   Lachnoclostridium sp. YL32: A4V08_27125Help
Entry
A4V08_27125       CDS       T04430                                 

Definition
(GenBank) diacylglycerol kinase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
lacy  Lachnoclostridium sp. YL32
Pathway
lacy00670  One carbon pool by folate
lacy00790  Folate biosynthesis
lacy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lacy00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    A4V08_27125
   00670 One carbon pool by folate
    A4V08_27125
Enzymes [BR:lacy01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     A4V08_27125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: ANU48939
UniProt: A0A1C7G9U0
Position
5695815..5696306
Genome map
AA seq 163 aa AA seqDB search
MNLIVAVDEKWGIGKDGGLLAHLPEDMKYFRETTRGRTVVMGRRTLESFPGGKPLKNRVN
MVLSRDEAYAPEGVRVYHSVEDVLEALRDCREEDVFIIGGGMIYREFLPYCSKAYVTYIH
RAFDVDTAFENLDQDENWKLESVSDGKEHEGISFEFRVYRRVR
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgaatctgattgttgcagtggatgaaaaatggggaattggtaaggacggcggtctcctt
gcgcatctcccggaggatatgaagtatttcagggagacgaccaggggaaggaccgtggtc
atgggacgcaggacactggagagctttccgggggggaagcccctgaagaaccgtgtgaat
atggtcctttccagagatgaggcgtatgcccctgagggcgtccgggtgtaccatagtgtg
gaggatgtgctggaggcattaagggactgccgtgaggaggatgtgttcatcatcggcgga
ggcatgatatacagggagtttcttccatattgcagtaaggcatatgtgacctacattcac
cgcgcctttgatgtggacacggcttttgaaaatctggatcaggatgaaaactggaaactg
gagtcggtcagcgatggtaaggagcatgagggtatttcgtttgaattcagagtatacaga
agggtaaggtga

DBGET integrated database retrieval system