KEGG   Lachnoclostridium sp. YL32: A4V08_34290Help
Entry
A4V08_34290       CDS       T04430                                 

Definition
(GenBank) adenylosuccinate synthase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
lacy  Lachnoclostridium sp. YL32
Pathway
lacy00230  Purine metabolism
lacy00250  Alanine, aspartate and glutamate metabolism
lacy01100  Metabolic pathways
Module
lacy_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:lacy00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    A4V08_34290
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    A4V08_34290
Enzymes [BR:lacy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     A4V08_34290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: ANU50143
UniProt: A0A1C7GCY6
Position
7187734..7189011
Genome map
AA seq 425 aa AA seqDB search
MVRAIVGANWGDEGKGKITDMLAKESDIIIRFQGGSNAGHTIINDYGKFALHLLPSGVFY
QHTTSIIGNGVALNIPYLIQEIESLVERGVPKPRILVSDRAQILMPYHVLFDTYEEARLA
GKSFGSTKSGIAPFYSDKYAKIGFQVSELFAEDLLREKAYRVCELKNVLLEHLYHKPLLD
PEEIIKELLSCRDMIAPYVCDTSAYLHEAIKEGRNILLEGQLGSLKDPDHGIYPMVTSSS
TLAAYGAIGAGIPPYEIKDITTVVKAYSSAVGAGAFVSEIFGDEADELRNRGGDGGEYGA
TTGRPRRVGWFDAVATRYGCRIQGTTEVAFTVLDVLGYLDEIPVCVGYEIDGQVTREFPT
TSMLEKARPVLTRLPGWKCGIRGIKRYQDLPENCRKYIEFVEKAIEAPISMVSNGPGRDD
IIMRR
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggtcagagcaattgtaggtgctaactggggtgacgagggaaagggtaagattacggat
atgcttgccaaggagtctgacattatcatccgtttccagggcggaagtaatgcgggccac
accattatcaatgattatggcaagtttgcccttcaccttcttccatcaggcgtgttttat
cagcatacaaccagcatcattggcaatggagtggctctcaatatcccttatctgattcag
gaaattgagtcgctggtggagcggggcgtgccaaagcccagaatcctggtttctgacagg
gctcagattctcatgccgtaccatgtgctgtttgacacctacgaggaagcgcgtctggcc
ggaaaatcctttggttccaccaagtccggtattgctcccttttattcagataaatatgcc
aagattggttttcaggtcagcgaactttttgccgaggatctgctgagggaaaaggcatac
agggtttgcgagctgaaaaatgtgcttctggaacacctgtaccataaacctcttctggat
cctgaggaaatcattaaggagcttctcagctgccgtgatatgattgcgccgtatgtatgc
gatacatccgcttatcttcatgaggccattaaggaaggaaggaatatcctcttagagggt
cagctgggctcccttaaggaccctgatcatggaatttatcccatggtcacatcttcttcc
acgctggctgcctatggagctatcggcgcaggcattcctccgtatgagattaaggatatc
acgacggttgtaaaagcttattccagtgcagtgggcgccggtgcctttgtcagtgagata
tttggggacgaggcggatgaactgagaaaccggggaggcgacggcggagagtacggcgcc
accacgggaaggcccagacgcgtgggctggttcgatgcggtggctaccagatacggatgc
cggattcagggaaccacggaagtggcatttacagtgctggatgtgctgggctatctggac
gagataccggtatgcgttggttatgagattgacgggcaggtcaccagggaattcccgact
acgtctatgcttgagaaggccagaccggtccttaccagactgcccggctggaagtgcggt
atccgcggcattaagcggtaccaggatcttccggagaattgccgcaaatacattgaattc
gtggagaaggcaattgaagctcctatttcaatggtatccaacggaccgggaagagacgac
attatcatgcgcaggtaa

DBGET integrated database retrieval system