KEGG   Lactobacillus acidophilus La-14: LA14_0655Help
Entry
LA14_0655         CDS       T02647                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase / Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lad  Lactobacillus acidophilus La-14
Pathway
lad00071  Fatty acid degradation
lad00072  Synthesis and degradation of ketone bodies
lad00280  Valine, leucine and isoleucine degradation
lad00310  Lysine degradation
lad00362  Benzoate degradation
lad00620  Pyruvate metabolism
lad00630  Glyoxylate and dicarboxylate metabolism
lad00640  Propanoate metabolism
lad00650  Butanoate metabolism
lad00900  Terpenoid backbone biosynthesis
lad01100  Metabolic pathways
lad01110  Biosynthesis of secondary metabolites
lad01120  Microbial metabolism in diverse environments
lad01130  Biosynthesis of antibiotics
lad01200  Carbon metabolism
lad01212  Fatty acid metabolism
lad02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lad00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LA14_0655
   00630 Glyoxylate and dicarboxylate metabolism
    LA14_0655
   00640 Propanoate metabolism
    LA14_0655
   00650 Butanoate metabolism
    LA14_0655
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LA14_0655
   00072 Synthesis and degradation of ketone bodies
    LA14_0655
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LA14_0655
   00310 Lysine degradation
    LA14_0655
   00380 Tryptophan metabolism
    LA14_0655
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LA14_0655
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LA14_0655
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LA14_0655
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lad04147]
    LA14_0655
Enzymes [BR:lad01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LA14_0655
Exosome [BR:lad04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LA14_0655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt FKBP_N ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AGK93828
Position
612214..613371
Genome map
AA seq 385 aa AA seqDB search
MKDIYIVAAKRTPFGKYRGFFKDASAVDMGVMALKGTLKASGINPEDVQALFMGNVLETG
LGENMARQVALYSGMKESSAAVTINEVCGSSLKAVRLAQGQMEMGDLDLVAVGGSESMTR
APYFINKEDKDNPEKMTSTMLNDGLMDAFSGKHMGITAENVAEKYNVSREEMDKFSLASH
QKAAKATEAGLLKNEILDVEIDGQVLDHDEPIRPGTSLEALGNLKPVFKEDGQVTAGNAS
PLTDGASMVILATKEKMEELDLTPVAKLGDFAEAGFDPAYMGYTPYFAVKKLLAKTGRSI
NDYDLIELNEAFAAQSIPVARDLEIPMDKLNIMGGAISLGHPLGATGTRLISTAVNGLKN
NDGKLALVTLCIGGGQAIAYEIENV
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatatttatattgtcgctgctaaaagaaccccttttggcaaataccgtggtttt
tttaaagacgcttctgcagttgatatgggagtaatggcacttaaaggaactttaaaagca
agtggaattaatcctgaagatgtgcaagctttatttatgggaaatgttttagaaacagga
cttggtgaaaatatggctcgtcaagttgctctttattcgggaatgaaggaaagctctgct
gcagttacaattaatgaagtttgtggatcgagtttaaaggccgtccgactcgcacaaggt
caaatggagatgggagatcttgatttagtagccgttggtggaagcgagagtatgactcgt
gcaccatattttatcaataaagaagataaagataatccagagaagatgaccagtacaatg
cttaatgacggtctaatggatgctttttcaggtaagcacatgggaattactgcagaaaat
gttgcagaaaaatataatgtttcgcgtgaagaaatggataaatttagtttagcatcacat
caaaaggctgctaaagctactgaagctggtttgttaaaaaatgaaattttggatgttgag
attgatggtcaagtattggatcacgatgaaccaattcgtccaggcactagcttagaagca
ttgggtaatttgaagccagtatttaaagaagatggtcaagtaacagccggaaatgcttca
cctcttactgacggtgccagcatggtgattttggctactaaagaaaagatggaagaatta
gatttaactcctgttgctaaattaggtgattttgcggaagccggttttgatcctgcatat
atgggatataccccttactttgctgtaaagaagctattagccaaaactggtcgttcaatt
aatgactatgatctaattgaattaaatgaagcttttgcagcacaaagtattccagttgca
cgagacttagaaattccgatggataagttaaatatcatgggaggagcaatttctcttggt
cacccattaggtgcgacgggtactcgtttgattagtacagcagttaatggattgaaaaat
aatgatggcaagttggctttagtcactctatgtattggtggtggtcaagcaattgcttat
gaaatcgagaacgtgtaa

DBGET integrated database retrieval system