KEGG   Lactobacillus acetotolerans: LBAT_0246Help
Entry
LBAT_0246         CDS       T03976                                 

Definition
(GenBank) methionyl-tRNA synthase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
lae  Lactobacillus acetotolerans
Pathway
lae00450  Selenocompound metabolism
lae00970  Aminoacyl-tRNA biosynthesis
lae01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lae00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    LBAT_0246
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    LBAT_0246
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lae01007]
    LBAT_0246
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lae03016]
    LBAT_0246
Enzymes [BR:lae01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     LBAT_0246
Amino acid related enzymes [BR:lae01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   LBAT_0246
Transfer RNA biogenesis [BR:lae03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    LBAT_0246
 Prokaryotic type
   Other AARSs
    LBAT_0246
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: BAQ56635
UniProt: A0A0D6A270
Position
247196..249172
Genome map
AA seq 658 aa AA seqDB search
MADKKTFYITTPIYYPSGRLTIGNAYTTVAADSMARYKRGQGYDTFFLTGTDEHGLKIEQ
KAEKQGIKPQEFVDKMAASYKKLWKSLDISYDKFIRTTDPEHVKSVQKIFERLLKQGDIY
LGEYTGWYSVEDEEYFTESQLAEVYKDDDGNVIGGKAPSGHDVQLVKEPSYFLKMSKYAD
RLFKYYKEHPDFILPHSREKEMVNNFIKPGLEDLSVTRTTVNWGIPVPSDPKHVVYVWID
ALSNYITALGYGTDDDSLFKKFWPADVQLVGKEIMRFHTIYWPVMLMALGLPLPKHIIGH
GWVLMKDGKMSKSKGNAVYPETITNRYGVDALRYYLMRALPFGSDGIFTPEDFVERVNFD
LANDLGNLLNRTVSMINQYQDGHVAAAPEKQDELGADLKSVADQVIKDYKKQMDTLHFSQ
ALDSIWKLISRSNKYIDETTPWALNKAGKNDALSRVLSNLAESLRLIAILISPIMTRTPV
KMFEQLGLDWDSTAEKKLGFGDFSWDTTVTPAPKPIFPRLKTNVEVKYIKEEMAKAKPKK
QTRSQQNQGKQIGIDDFDKVKIQVGKILAVEPVQGSKKLLQFQLDFGNGQEKQILSGIRK
FYPNASELLNKKVLAVTNLKPRKMLGHISQGMLLSSEKGGAVKLAIVGDEHEIGAELG
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atggctgataaaaaaactttttatattacaaccccgatttattacccatctggtcgttta
accataggtaatgcttatactacggttgcggctgattcaatggcacgctataagcgtggc
cagggctatgacacatttttcttaaccgggacagatgaacatggtcttaaaattgagcaa
aaggcagaaaagcagggtattaagcctcaggaatttgtagataagatggctgcttcttac
aagaaattatggaagagcttagatatttcgtacgataagtttattcgtacaactgatcct
gagcacgttaagagtgtgcaaaagatttttgaaagacttttaaaacagggtgatatttac
ttaggtgaatataccggttggtattcagttgaagatgaggagtactttactgagtctcaa
ttagccgaagtttataaggatgatgacggtaatgttattggtggtaaagcgccgtctggt
catgatgtccaactagttaaggaaccatcatacttccttaagatgagcaagtacgctgat
cgattatttaagtattataaggaacaccctgacttcatattgccgcattctcgagaaaaa
gaaatggttaataactttattaagccgggtttggaagatctttccgttacccggacgact
gttaattggggaattcccgtaccaagtgatccgaaacacgttgtttacgtgtggattgat
gctttatctaactatattactgcacttggttatggtacggatgatgattccttgtttaag
aaattctggccggctgacgttcaattagtgggtaaggaaatcatgcgtttccacacgatt
tactggccagttatgctgatggctttagggttaccacttcctaaacatattattggccat
ggctgggtcttgatgaaggacggtaaaatgtctaagtctaaaggtaatgccgtttacccg
gagacgatcactaatcgttatggtgttgacgctctgcgttattacctaatgcgtgcactt
ccatttggttcagacggaattttcacacctgaagactttgttgaacgagttaactttgat
ttggctaacgatctaggaaatttgctcaatagaacagtttctatgattaaccagtatcaa
gatgggcatgttgccgctgctcccgagaagcaggatgagctgggtgccgatctaaagtct
gtagctgatcaagtaattaaagactataagaaacaaatggatacattgcacttttcacag
gctctggatagcatttggaagttaattagtcgttctaacaaatatattgatgaaacaacg
ccttgggctttaaataaggcaggcaaaaacgatgctttatctagggtactatctaattta
gctgaaagtttacgtttaattgccattcttatttctccaattatgactagaacaccggtt
aagatgtttgagcaattaggtttggattgggatagtaccgctgaaaagaagcttggattt
ggtgattttagttgggatactacagtaacgcctgctcctaaaccaatttttcctcgtctt
aagacaaacgtggaagttaagtatattaaagaagaaatggctaaagctaaaccgaagaag
cagactcgaagtcagcaaaatcagggtaagcaaattggcattgatgactttgataaagtt
aagattcaagttgggaagattttagcagtagaaccggttcaaggttcaaagaaattgtta
caattccagcttgactttggtaatggtcaagaaaagcagattttaagcggtattcgtaag
ttttatcccaatgctagtgagctgttaaacaaaaaagttttggcagttactaatttgaag
cctcgtaagatgctgggccatattagtcagggaatgcttttgtctagtgaaaaaggcggg
gcagttaaattggctattgttggtgatgaacatgaaattggggctgaattaggttaa

DBGET integrated database retrieval system