KEGG   Lactobacillus acetotolerans: LBAT_0310Help
Entry
LBAT_0310         CDS       T03976                                 

Definition
(GenBank) L-fuculose phosphate aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
lae  Lactobacillus acetotolerans
Pathway
lae00051  Fructose and mannose metabolism
lae01100  Metabolic pathways
lae01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    LBAT_0310
Enzymes [BR:lae01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     LBAT_0310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: BAQ56699
UniProt: A0A0D6A209
Position
311951..312601
Genome map
AA seq 216 aa AA seqDB search
MDYIKERKQIVEYGKQMITNHLTTGTGGNLSIYIPEKKIMLISPSGIDYYKTKLEDVVVM
DLDGHVLEGKRKPSSEYELHSIFYKNKAGIHSVVHAHADFATAMSCLRINIPPLHYIMAD
IGDELRCTNYKIYGSPEIAKEAYRVMGDNKGILLANHGLLAIGSDIDSAMGIARNIELMC
KLYTYASIVGKPVILSKEEMAAVTKKFQNYGQPKGE
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggattacattaaagagcgaaaacaaatcgttgaatatggcaaacagatgattactaat
catctcactacggggactggtggtaatttaagtatttatatccctgaaaagaagattatg
ttaatcagcccaagtgggattgattattacaaaactaagttggaagacgtcgttgtcatg
gatttggatggtcatgtccttgaaggcaagcgcaaaccatctagtgaatatgaattacac
agtattttttataaaaataaagcaggtattcattctgttgttcatgcacatgctgatttt
gcgacggcaatgtcttgcttacggattaatatcccaccacttcattacattatggctgat
atcggtgatgaattacgttgcactaattataaaatttatggttccccggagattgctaag
gaagcttaccgcgttatgggtgacaataagggtatccttttagctaatcatggcttgttg
gctattggcagtgacattgattctgctatgggaattgctagaaatattgaattgatgtgc
aagttgtatacttatgcttcgattgtgggtaaacccgtgattttatctaaagaagagatg
gctgccgtaactaaaaaatttcagaattacgggcaacctaaaggtgaataa

DBGET integrated database retrieval system