KEGG   Lactobacillus acetotolerans: LBAT_0360Help
Entry
LBAT_0360         CDS       T03976                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
lae  Lactobacillus acetotolerans
Pathway
lae03010  Ribosome
Brite
KEGG Orthology (KO) [BR:lae00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    LBAT_0360
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:lae03011]
    LBAT_0360
Ribosome [BR:lae03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    LBAT_0360
  Bacteria
    LBAT_0360
  Archaea
    LBAT_0360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: BAQ56749
UniProt: A0A0D6A260
Position
366729..367082
Genome map
AA seq 117 aa AA seqDB search
MAEQISSAKAEARTVRIAPRKARLVVDLIRGKSVAEALAILEFTPRAASPIVEKVLRSAI
ANAEHNYDLESANLYVSEAYVNEGATLKRFRPRAKGMASPINKRTSHVVVVVSEKND
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atggcagaacaaattagttcagctaaggctgaagcaaggactgttcgcatcgctccaaga
aaagctcgattagtcgttgatttaattcgtggcaagagcgttgctgaagcattagcaatc
ttggaatttacgcctagagctgcttccccaatcgttgaaaaagttttgcgttcagctatt
gctaatgcagaacacaactacgatcttgaaagtgctaatctttacgtatctgaagcatac
gtaaacgaaggtgcaactttgaagagatttcgtcctcgtgctaaaggcatggcttctcca
attaataagagaactagtcatgtagttgtagtagtttcagaaaagaacgattaa

DBGET integrated database retrieval system