KEGG   Lactobacillus acetotolerans: LBAT_0390Help
Entry
LBAT_0390         CDS       T03976                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
lae  Lactobacillus acetotolerans
Pathway
lae00625  Chloroalkane and chloroalkene degradation
lae01100  Metabolic pathways
lae01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lae00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LBAT_0390
   00361 Chlorocyclohexane and chlorobenzene degradation
    LBAT_0390
Enzymes [BR:lae01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     LBAT_0390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase_like
Motif
Other DBs
NCBI-ProteinID: BAQ56779
UniProt: A0A0D6A288
Position
complement(382320..382979)
Genome map
AA seq 219 aa AA seqDB search
MSTYETLIFIPEGSLLNEKVAERNALRQTLKHFQHEFGPAERLKYTSLQKQVKLLPQNKR
IDLLLQTFLKQDLSETKAVFEHKMREQDQLIKGSPEFLDQVKGKLNLILLAKESKGQILP
RLAKSELMNYFSVQYFKDDFSKPLPNKDIFFKILDDNPTIDPDTTLVIGTNLDEEIQGAE
NTNLYSLWLAPRKEKLPINPHPTLHLSKLSDLLFYLNLN
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
gtgtctacatatgaaactttaatcttcatccctgaaggaagtttattaaatgaaaaagta
gctgaaagaaatgctttaaggcaaacgctaaaacattttcaacatgaatttggaccagca
gaacgtttaaaatatacaagtttacaaaaacaagtaaaattattaccacaaaacaaaaga
attgatttgttattacaaacttttttaaaacaggacttatccgaaactaaagctgtcttt
gaacataaaatgcgggagcaagaccaactaattaaaggaagtcccgaatttcttgaccaa
gtaaaaggcaagttaaatttaattttacttgcaaaagaaagtaagggacaaattttgcct
cgtttagcgaaaagtgaactgatgaattattttagcgtccaatactttaaagatgatttt
agcaagcctctgcctaataaagatatcttctttaaaattttagatgataatcccacaatc
gatccagatacaacgttggtaattggaactaaccttgatgaagaaattcaaggtgcagaa
aacactaatctatattcattatggcttgctcccaggaaagaaaaacttcctatcaatcca
cacccaacgcttcatttatcaaaattaagtgatttattattttacctaaacctgaattaa

DBGET integrated database retrieval system