KEGG   Lactobacillus acetotolerans: LBAT_1229Help
Entry
LBAT_1229         CDS       T03976                                 

Definition
(GenBank) truncated acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lae  Lactobacillus acetotolerans
Pathway
lae00071  Fatty acid degradation
lae00072  Synthesis and degradation of ketone bodies
lae00280  Valine, leucine and isoleucine degradation
lae00310  Lysine degradation
lae00362  Benzoate degradation
lae00620  Pyruvate metabolism
lae00630  Glyoxylate and dicarboxylate metabolism
lae00640  Propanoate metabolism
lae00650  Butanoate metabolism
lae00900  Terpenoid backbone biosynthesis
lae01100  Metabolic pathways
lae01110  Biosynthesis of secondary metabolites
lae01120  Microbial metabolism in diverse environments
lae01130  Biosynthesis of antibiotics
lae01200  Carbon metabolism
lae01212  Fatty acid metabolism
lae02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LBAT_1229
   00630 Glyoxylate and dicarboxylate metabolism
    LBAT_1229
   00640 Propanoate metabolism
    LBAT_1229
   00650 Butanoate metabolism
    LBAT_1229
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LBAT_1229
   00072 Synthesis and degradation of ketone bodies
    LBAT_1229
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LBAT_1229
   00310 Lysine degradation
    LBAT_1229
   00380 Tryptophan metabolism
    LBAT_1229
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LBAT_1229
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LBAT_1229
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LBAT_1229
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lae04147]
    LBAT_1229
Enzymes [BR:lae01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LBAT_1229
Exosome [BR:lae04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LBAT_1229
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: BAQ57618
UniProt: A0A0D6A484
Position
complement(1267683..1268552)
Genome map
AA seq 289 aa AA seqDB search
MKEIYVVAAKRTPFGKYNGFFKNESATDLGVMALKGTLNSAQIKADDIEALLMGNVLSTG
LGENMARQVALCSGMKNTSASTTINEVCGSSLKAMRLAQGQMEMGDLNLVAVGGAESMTN
APYFVANQDDAQNHLQSSMLIDGLNDAFLKQHMGITAENVARKYHVSRKEMDEFSLRSHQ
KATQAVKNGSFKNEIIPSNLDGKKLTHDESIRPDTSMAALANLKPSFKRDGKVTAGNASP
LSDGASMVILATGEKIDELNLKPLARLGAFAESGIDPAYMGYAPLLRGD
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaatttatgttgtcgctgctaaaaggacaccatttggtaaatacaatggcttt
tttaaaaatgaatctgctactgatctgggtgtgatggcattaaaagggactttgaatagc
gctcaaattaaagctgatgacattgaggcattactgatggggaatgtgctgagtaccggc
ttaggcgaaaatatggctaggcaggttgctttgtgttcagggatgaagaatacaagtgcc
agcacaactattaatgaagtgtgcggatcaagtcttaaagccatgcgccttgcacaggga
caaatggagatgggtgacttaaatttagtagcggttggcggtgctgaaagcatgaccaat
gcaccgtattttgttgcaaatcaagatgatgcgcagaatcatttacaaagtagcatgctt
attgatggcttaaacgacgcttttttaaagcagcatatgggaattaccgctgaaaatgta
gctagaaaatatcatgtttctagaaaagaaatggatgaatttagtttacgttcccaccaa
aaagctactcaagccgtgaaaaatggctctttcaagaatgaaattattcctagcaactta
gatggtaaaaaattaactcacgatgaaagcattcggccggatactagcatggccgctcta
gccaacttaaaaccatcttttaaaagggatgggaaggtaacagctggaaatgcttcgccc
cttagtgacggtgccagcatggtaattttggcaactggtgaaaagatagatgaattaaat
ttaaagccgcttgcacgtttaggagcatttgcggaaagtgggattgatcccgcctatatg
ggttatgcccccttactacgcggtgactaa

DBGET integrated database retrieval system