KEGG   Lactobacillus acidophilus FSI4: SD55_0558Help
Entry
SD55_0558         CDS       T03681                                 

Gene name
gatB
Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
laf  Lactobacillus acidophilus FSI4
Pathway
laf00970  Aminoacyl-tRNA biosynthesis
laf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:laf00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SD55_0558 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:laf03029]
    SD55_0558 (gatB)
Enzymes [BR:laf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     SD55_0558 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     SD55_0558 (gatB)
Mitochondrial biogenesis [BR:laf03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    SD55_0558 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AJP45980
UniProt: A0A3A9Y363
Position
522854..524284
Genome map
AA seq 476 aa AA seqDB search
MNFKSTIGLEVHFELKTKSKIFSPSPVTYGAEQNTETNVIDWAMPGTLPMVNKNVYRLGI
MVALATHSHILPTTHFDRKNYFYPDNPKAYQITQFFQPLARDGYIEVEVRGKKKRIGIHE
MHIEEDAGKNTHGTNGYSYVDLNRQGVPLLEVVSEPDMEDPEEAYAYLEKLRKIVQFTGA
SDVKMEEGSMRVDTNISIRPAGQKELGTKVEMKNLNSFDHVRRSLAYEEKRQEQVLLAGG
HIQLSTRRFDEATGKTVLERVKEGASDYRYFPEPDIAPDHISQEWIDQIAKELPKSPFDR
YDDYVNKFGLKPYDANVLLQTKESSDFFDAAVAAGADPTLAANWMNTQVNGYLNDNRVSL
EDIKLTPENLAKMIKLIQDGTISSKIAKKVFAETVANGTDPKKYVEDNGMVQLSDTSVLE
PMVKKVVDDNPQSVEDFKNGKDRAIGFLVGQIMKQTRGKANPKMVNKLLNQELQSR
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgaattttaaatcgactatcggacttgaagtccacttcgaattaaagacaaagagcaag
attttctctccttcaccagtaacctacggtgctgagcaaaacacggagactaatgttatt
gactgggccatgcctggtaccttgccaatggttaacaagaatgtttaccgcttaggtatt
atggttgctttagcaacacattcacatattttgccaactactcactttgaccgtaagaac
tacttctatcctgataacccaaaggcttaccagattactcagttcttccaaccacttgct
cgtgatggttatattgaagttgaagttcgtggcaagaagaagagaatcggtattcatgaa
atgcacatcgaagaagatgccggtaagaacactcacggaactaatggttactcatacgtt
gacttaaaccgtcagggtgttccacttcttgaagttgtttctgaacctgacatggaagat
ccagaagaagcttacgcataccttgaaaagttgcgtaagattgttcaatttactggtgct
tctgacgttaagatggaagaaggttcaatgcgtgttgataccaacatttctatccgtcct
gcaggtcaaaaggaacttggtactaaggttgaaatgaagaacttgaactcatttgaccac
gtaagacgttcacttgcgtacgaagaaaagcgtcaagaacaagttcttttagctggtggt
catattcaactttcaactcgtcgttttgacgaggctactggtaagactgttttggaacgt
gttaaggaaggtgcttccgactaccgttacttcccagaaccagatattgcacctgatcat
attagtcaagaatggattgaccaaattgctaaggaacttccaaagagtccattcgatcgt
tacgatgactatgtaaacaaatttggtttgaagccatatgatgctaatgttttgcttcaa
actaaggaaagttcagacttcttcgatgcagctgtagcagctggtgcagatccaactctt
gcggctaactggatgaatactcaagtaaatggttatttgaatgataaccgtgtaagctta
gaagatatcaagcttacgccagaaaacttagctaagatgattaagttgatccaagatggt
actatttcatctaagatcgctaagaaggtctttgctgaaactgttgctaacggtactgat
cctaagaagtacgttgaagacaatggcatggttcaattgtcagatacttctgtcttggaa
ccaatggttaagaaggttgttgatgataaccctcaatcagttgaagacttcaagaatggt
aaggatcgtgcaattggtttcttagttggtcaaatcatgaagcaaactcgtggtaaggct
aaccctaagatggttaataagttacttaaccaagaattgcaaagtcgttaa

DBGET integrated database retrieval system