KEGG   Lactobacillus acidophilus FSI4: SD55_1882Help
Entry
SD55_1882         CDS       T03681                                 

Gene name
purA
Definition
(GenBank) adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
laf  Lactobacillus acidophilus FSI4
Pathway
laf00230  Purine metabolism
laf00250  Alanine, aspartate and glutamate metabolism
laf01100  Metabolic pathways
Module
laf_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:laf00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SD55_1882 (purA)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SD55_1882 (purA)
Enzymes [BR:laf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     SD55_1882 (purA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt DUF3069
Motif
Other DBs
NCBI-ProteinID: AJP47170
UniProt: A0A3A9XWT4
Position
complement(1900722..1902011)
Genome map
AA seq 429 aa AA seqDB search
MTAVAVVGSQWGDEGKGKITDFLSKDAAMAVRSNGGNNAGHTIDIDGKTFKMRLIPSGIF
AAKDNTVIGNGVVINPEVMFSELENLEKNGIDTSGLRISNRAHIIMPYDIKQDEYQEEAK
GKNKIGTTKNGIGPTYMDKASRIGIRVCDLLEKDTFEEKLRTNLEIKNELFTKVYGKPAL
KFEDIFDKYYEYGQRMKKYVTDTSVLVNDALDQNKKVLFEGAQGIMLDIDEGTYPFVTSS
NTISGGIASGIGIGANRLDTVIGVCKAYTTRVGAGPFPTELLDETGDRIREIAHEYGTVT
GRPRRVGWFDSVALRHSKRVAGINGLSLNLLDVFSGFDKIKICTAYELDGEKIDYYPASL
KELYRCKPVYEELPAWEEDITQVKTWDELPENAKKFLNRISELVGVPLVTVSVGPDREQT
IVLKNPWEM
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgacagcagttgcagttgtagggagccaatggggcgatgaaggtaaaggaaagattact
gactttttaagtaaagatgccgcaatggcagttcgctcaaacggtggtaataacgcaggt
cacaccattgatattgatggcaagactttcaagatgcgtttaattccttcaggaattttt
gcagctaaggataacacagttattggtaatggtgttgtaattaacccagaagttatgttt
agtgaacttgaaaatcttgaaaagaacggtattgatactagtggcttgagaatttctaac
cgtgctcacattattatgccttacgacattaagcaagatgaataccaagaagaagctaag
ggtaaaaataagattggtactactaagaatggtattggtccaacttacatggataaagct
tcaagaataggtattcgcgtttgtgatttactcgaaaaagatacttttgaagaaaagctt
cgtactaatcttgaaattaagaacgaattatttactaaggtttatggtaaaccagctctt
aaatttgaagatatttttgacaagtactatgaatatggtcaaagaatgaagaaatacgtt
actgacacttcagttttagtaaatgacgcgcttgaccaaaataagaaggttttatttgaa
ggggcacaaggtatcatgcttgatattgatgaaggtacttacccatttgtaacttcttca
aacactatttcaggtggtattgcttcaggtatcggtattggtgccaaccgtttggatact
gtaattggtgtctgcaaagcttacactactagagtaggtgcaggtccattcccaacagaa
cttcttgatgagactggtgatcgtattcgtgaaattgctcatgaatatggtactgttact
ggtcgaccacgccgtgtgggttggtttgactccgttgctcttcgtcactcaaagcgtgtt
gctggtatcaatggccttagcttaaacttgcttgatgtattttcaggttttgacaagatt
aagatttgtactgcttatgaacttgatggtgaaaagattgattactatccagcaagttta
aaggaactttaccgttgtaagccagtttatgaagaacttccagcatgggaagaagatatt
actcaagttaagacttgggatgaacttccagaaaatgctaagaaattcttgaaccgtatt
tctgaattagtgggtgttccactagtgactgtttcagttggacctgaccgtgaacaaact
atcgtattgaagaatccatgggaaatgtaa

DBGET integrated database retrieval system