KEGG   Lactobacillus acidophilus FSI4: SD55_1916Help
Entry
SD55_1916         CDS       T03681                                 

Gene name
dltA
Definition
(GenBank) cytochrome C peroxidase
  KO
K03367  D-alanine--poly(phosphoribitol) ligase subunit 1 [EC:6.1.1.13]
Organism
laf  Lactobacillus acidophilus FSI4
Pathway
laf00473  D-Alanine metabolism
laf01100  Metabolic pathways
laf01503  Cationic antimicrobial peptide (CAMP) resistance
laf02020  Two-component system
Brite
KEGG Orthology (KO) [BR:laf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    SD55_1916 (dltA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SD55_1916 (dltA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    SD55_1916 (dltA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:laf01504]
    SD55_1916 (dltA)
Enzymes [BR:laf01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.13  D-alanine---poly(phosphoribitol) ligase
     SD55_1916 (dltA)
Antimicrobial resistance genes [BR:laf01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, dltABCD operon [MD:M00725]
    SD55_1916 (dltA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AJP47201
UniProt: A0A3A9Y6H1
Position
complement(1934634..1936148)
Genome map
AA seq 504 aa AA seqDB search
MIQDVIKRIDEIAENEPDRVVYDYLGETNTYGDLKKRSNAWAHKIASMDIPEHAPIMIWG
GQTFEMIASFLGCVKSGHAYIPIASYSNAERLTMIQDVSKSPMVLEIDPLPDVNLDGIKV
LKANEVEDGDFTVDESNFVEGDENYYIIFTSGTTGKPKGVQISHDNLLSFVNWELSDFNL
PEHPSFLAQAPYSFDLSVMSLYPALVSAGKLVVLPHDVTQNFGQLFQTLPKMQFNVWVST
PSFAQMCFLDKTFDAEHHPDLTHFLFCGEELPHSEADMLKKKFPESHIFNTYGPTETTVA
VTQVEITDEILEKYDRLPIGRVKEDTKITIDTSKGDKPGEGEIIISGPSVSKGYMNNPEK
TEAAFFQNEGDKYRSYRSGDAGFFDGDMLFYRGRIDFQIKFNGYRIELEEINFYLSKNEF
VRYGVAAPKYNKDHTVKQIVAEIELKHGVRRKYSDAQLTKLIREDLAKNVMPYMIPQRYV
YQDTLPISQNGKVDIKAVIKEVNK
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgattcaagatgttattaagagaattgacgagatagctgaaaatgaaccagatcgtgta
gtttacgattatctcggtgaaaccaatacatatggtgaccttaagaagcgttcaaacgct
tgggcacacaagattgctagtatggatatcccagaacatgcaccaatcatgatctggggt
ggtcaaacatttgaaatgattgctagtttcttaggttgtgttaaatcaggccacgcatat
attccaattgcaagttattcaaatgctgaacgtttaacaatgattcaagatgtttcaaaa
tcacctatggttttggaaattgatccattgccagacgttaatttagacggcatcaaggta
cttaaagctaatgaagttgaagatggcgactttacagttgatgaaagtaatttcgttgaa
ggcgacgaaaattactatattatctttacttcaggtactactggtaagccaaagggtgta
caaatcagtcatgataatttgttgagttttgtaaactgggaattatcagattttaatttg
ccagaacacccaagctttttggcacaagctccatactcatttgacttgtcagttatgagc
ctttatcctgcacttgtttcagcaggaaagcttgttgttttaccacatgatgttacgcaa
aactttggtcaattgttccaaactttaccaaaaatgcaatttaatgtttgggtatcaact
ccatcatttgcacaaatgtgtttcttagataaaacctttgatgcagaacatcatccagac
ttaactcacttcttattctgtggtgaagaattaccacatagtgaagctgatatgcttaag
aagaagttcccagaaagtcatatttttaatacttacggtcctactgaaactacagttgct
gtgactcaagtagagatcactgatgaaatacttgaaaagtatgatcgtctaccaattggt
agagtaaaagaagacactaagattactattgatacttcaaagggagataagcctggcgaa
ggtgaaatcattatcagtggtcctagcgtttcaaaagggtacatgaataaccctgaaaag
accgaagctgctttcttccaaaatgagggcgacaagtatcgcagctaccgtagtggagat
gctggattctttgatggtgatatgctattttatcgcggtagaatcgacttccaaatcaag
ttcaatggttacagaatcgaacttgaagaaattaatttctacttgtcaaagaatgaattt
gtacgttatggtgtcgcagcacctaaatacaataaagatcatactgtaaagcaaattgtt
gctgaaatcgaattgaagcatggcgttcgtcgtaagtattctgatgcacaacttactaag
ttgattcgtgaagacttagctaagaacgtgatgccttacatgattccacagcgttatgtt
taccaagatacattaccaatttctcaaaacggtaaggtggatattaaggcagttattaag
gaggttaataagtag

DBGET integrated database retrieval system