KEGG   Vibrio anguillarum M3: N175_00090Help
Entry
N175_00090        CDS       T02823                                 

Gene name
ompR
Definition
(GenBank) transcriptional regulator
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
lag  Vibrio anguillarum M3
Pathway
lag02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lag00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    N175_00090 (ompR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:lag02022]
    N175_00090 (ompR)
Two-component system [BR:lag02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   N175_00090 (ompR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C FleQ
Motif
Other DBs
NCBI-ProteinID: AGU56329
Position
1:complement(20472..21191)
Genome map
AA seq 239 aa AA seqDB search
MQENYKILVVDDDARLRALLERYLSEQGFLVRSVANSEQMDRLLTRENFHLMVLDLMLPG
EDGLSICRRLRNANNMLPILMLTAKGDEVDRIVGLEVGADDYLPKPFNPRELLARIKAVL
RRQVIEAPGAPSAEESVVEFGEFRLNLGTREMFRGDEPMPLTSGEFAVLKTLVTNAREPM
SRDKLMNMARGREYSAMERSIDVQISRLRRMLEVDPSKPRYIQTVWGLGYVFVPDGKES
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgcaagagaactataaaattttagtggtggatgatgatgcgcgtttacgtgcattgctt
gagcgttacttgtcagagcaaggttttctggtgcgtagtgtcgccaatagcgaacagatg
gatcgcctgctcactcgtgaaaacttccacctaatggtgcttgatttgatgttaccgggt
gaagatggtttgtctatttgccgccgcttgcgtaacgccaataatatgttgccgatttta
atgctgaccgccaaaggcgacgaagtggatcgtattgttggcttggaggtgggtgcggat
gattacctgcccaaaccgtttaacccgcgtgaactactggcgcgaatcaaagccgtgcta
cgccgccaagtgattgaagcccccggcgcgccaagtgctgaagaatcggtggttgagttt
ggtgagtttcgcctgaatttaggtacccgagaaatgttccgtggcgatgagccgatgccg
ctcacttccggtgaatttgccgtattgaagaccttagtcaccaatgcgcgtgagccaatg
tcgcgcgataagttgatgaatatggcaagagggcgtgaatactccgcaatggagcgctcg
attgatgtgcaaatctcgcgtttacgtcgcatgcttgaagtggatccaagcaaaccacgc
tacatacaaacggtgtggggcttaggttacgtcttcgttccagatggtaaagagtcttaa

DBGET integrated database retrieval system