KEGG   Vibrio anguillarum M3: N175_05995Help
Entry
N175_05995        CDS       T02823                                 

Definition
(GenBank) aminotransferase AlaT
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
lag  Vibrio anguillarum M3
Pathway
lag00220  Arginine biosynthesis
lag00250  Alanine, aspartate and glutamate metabolism
lag00290  Valine, leucine and isoleucine biosynthesis
lag01100  Metabolic pathways
lag01110  Biosynthesis of secondary metabolites
lag01130  Biosynthesis of antibiotics
lag01210  2-Oxocarboxylic acid metabolism
lag01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lag00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    N175_05995
   00290 Valine, leucine and isoleucine biosynthesis
    N175_05995
   00220 Arginine biosynthesis
    N175_05995
Enzymes [BR:lag01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     N175_05995
    2.6.1.66  valine---pyruvate transaminase
     N175_05995
Amino acid related enzymes [BR:lag01007]
 Aminotransferase (transaminase)
  Class I
   N175_05995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP ERCC3_RAD25_C
Motif
Other DBs
NCBI-ProteinID: AGU57305
Position
1:complement(1223582..1224796)
Genome map
AA seq 404 aa AA seqDB search
MQNIGMSSKLDNVCYDIRGPVLKHAKRMEEEGHKILKLNIGNPAPFGFDAPDEILVDVIR
NLPTSQGYCDSKGIYSARKAVVQHYQKKGLRSLDVEDVYIGNGASELIVMAMQALLNNGD
EMLVPAPDYPLWTASVALSGGTAVHYLCDEEADWYPDLNDINSKITPKTRGIVLINPNNP
TGAVYSRDFLLEIVEIARKHKLIIFADEIYDKILYDGATHTPISTLADDVLMVTFNGLSK
AYRVCGFRGGWMFLTGPKHIAKGYVAGLEMLASMRLCANVPMQHAIQTALGGYQSINELI
LPGGRLLEQRDRAWELINQIPGVSCVKPKGAMYLFPKIDTKMYSIKDDQKMVLDFLKQEK
VLLVQGTGFNWPKPDHFRIVTLPHIEDLEIAIGRFERFLSTYSQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatatcgggatgtcgtcaaaactcgacaatgtctgctatgacattaggggtcct
gtactcaaacatgctaaacgcatggaggaagaggggcataaaatactgaagttaaacatt
ggtaaccccgccccatttggctttgacgccccagatgaaatcctagttgatgtgatccgt
aatctgcctacttcacaaggctattgcgactcaaaggggatctattccgcgcgcaaagcc
gtggtgcaacactaccagaaaaaagggctacgtagcctagatgtagaagatgtttacatc
ggtaatggtgcttcagagcttatcgtgatggcgatgcaagcgctgcttaataatggcgat
gaaatgcttgtccctgctcctgattatccattatggaccgcttcggtcgccctctccggt
ggcactgctgtgcattacttgtgtgatgaagaagccgattggtatcctgatctcaacgac
atcaacagtaaaatcacgcccaaaacacgcggtattgtgttgatcaaccccaataaccca
acaggtgctgtctatagccgtgatttcctgctggaaattgttgagattgcccgcaagcat
aaattgatcattttcgccgacgaaatctacgacaaaatcttatacgatggtgcaacccat
acgcccatttcaacactggctgatgacgttttaatggtcacttttaacggcctgtcaaaa
gcgtaccgtgtgtgcgggttccgtggtggttggatgttccttaccgggccaaaacacatc
gccaaaggttatgtggctggtttggaaatgcttgcctcaatgcgtttgtgtgccaacgtg
cccatgcagcatgcgattcaaaccgcattaggtggctatcaaagtatcaatgagctgatt
ttacccggcggccgactgctcgaacagcgcgatcgcgcgtgggaattgatcaaccagatc
cccggcgtctcatgtgtcaaacctaaaggagccatgtacctgttcccgaaaatcgacacg
aaaatgtacagcattaaagatgaccaaaaaatggtgctcgacttcttaaaacaagagaaa
gtgctattggttcaaggaacgggctttaactggccaaaaccggaccacttccgcattgtc
accttaccgcatattgaagatttggaaattgccattggccgcttcgaacgtttcttatcg
acctacagtcagtag

DBGET integrated database retrieval system