KEGG   Vibrio anguillarum M3: N175_06420Help
Entry
N175_06420        CDS       T02823                                 

Definition
(GenBank) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
lag  Vibrio anguillarum M3
Pathway
lag00780  Biotin metabolism
lag01100  Metabolic pathways
Module
lag_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:lag00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    N175_06420
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lag01007]
    N175_06420
Enzymes [BR:lag01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     N175_06420
Amino acid related enzymes [BR:lag01007]
 Aminotransferase (transaminase)
  Class II
   N175_06420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AGU57386
Position
1:1318678..1319841
Genome map
AA seq 387 aa AA seqDB search
MIFSTMPAFNSRISAALSARHDLGLSRSLIELEGGNQVRLCKDGRQYLNFSSNDYLGLAH
DSELIAAWQQGLSMYGCGSGASPLVTGFSSAHRNLEANLCEWLGYERAILFGSGFSANQA
LLFSLLNKDDLLLQDKLNHASLMEAGMLCAASMKRFRHNDVTHLKQQFNSDSHTLVVTEG
VFSMDGDCAPLCEITDALQGEAWLAVDDAHGIGVLGEGGAGSCSAAGIKPQLLVVTFGKA
LGLSGAAILCNQEVGDFLTQFARHHVYSTAMPPAQAYAVTHAISMVTQQPWRREKLTELQ
AYYAESMQGFDGYVETLTPIKPYLVGEAQTALNIADQLRHSGCWLTAIRPPTVAQGRARL
RITLTANHTIADIEQLTTQLQRALQES
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgatcttttctacgatgccagcgtttaattcacgtatttcagcggcgctcagtgctcgt
cacgatcttgggctttctcgttctcttatcgagcttgagggaggcaaccaggttcgattg
tgcaaagatggccgccagtatcttaacttttccagtaacgattaccttggccttgcacat
gactcagaattgattgccgcttggcagcaagggctgagtatgtatggttgcggtagtggc
gcatctcctttggtcacaggctttagctcagcccatcgcaaccttgaagctaacttgtgt
gagtggctaggttatgagcgagccattttgtttggctcaggttttagtgccaatcaggca
ctgctgtttagcttgctcaacaaagatgatttgctgctgcaagataaacttaaccacgcc
tctttgatggaagcaggaatgctttgcgcagccagtatgaagcgttttcggcacaacgat
gtcactcatcttaagcaacagtttaacagcgatagtcatacgttagtggtgactgaaggg
gtctttagcatggatggtgattgtgcaccgctgtgcgaaatcacggatgcactgcaaggt
gaagcgtggttggcagtcgatgatgcacacggcatcggtgtgttgggcgagggtggggca
ggcagttgcagcgcggcaggaataaaaccacagctcttagtggtgacttttggcaaagcc
ttggggttatcgggtgcagctatcttatgcaatcaagaggtgggtgactttcttacgcag
tttgctcgtcaccacgtctattctacagctatgccgccagcgcaagcttatgcagtaact
catgctatttcaatggtcactcagcagccgtggcgcagagaaaaactgactgagctgcaa
gcttattacgctgaatccatgcaaggtttcgatggctatgttgaaacgctaacgccaatc
aaaccctaccttgttggtgaggcgcaaacagcattgaatatcgccgatcaattgcgacat
agcgggtgttggttgaccgcgattcgcccaccaacggtggctcaaggccgtgcccgattg
cgtatcactctaaccgccaatcacactattgctgacatagagcaactaaccacacaactg
caacgtgcgctacaggagagctga

DBGET integrated database retrieval system