KEGG   Vibrio anguillarum M3: N175_07360Help
Entry
N175_07360        CDS       T02823                                 

Definition
(GenBank) type VI secretion protein
Organism
lag  Vibrio anguillarum M3
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GPW_gp25
Motif
Other DBs
NCBI-ProteinID: AGU57545
Position
1:1533504..1533920
Genome map
AA seq 138 aa AA seqDB search
MSLMAKLTQSWNDDIDSVRDAIVDNVCDLISSRAPLCSEMLLSEKGTIAELGMRNMARAQ
SKNNTSDIVAEIEVLVRNFEPRLSQVEIDVQEGELGSNQLSFRLSAVVHSELGDEAIVLD
SFLDLSSNKLDVRKSNFV
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgagcttaatggctaagttaacccaaagctggaatgacgatatcgatagtgttcgagat
gcaattgttgataacgtctgtgatcttatttccagccgagcacctctgtgttcagagatg
cttttatcggaaaaaggaacgattgccgagctcggtatgcgcaacatggctcgcgctcaa
agtaaaaacaacaccagtgacattgtcgcagaaattgaagtgctggtccgaaacttcgaa
cctcgcctgagccaggtagagattgatgttcaagaaggggaactgggtagcaaccaattg
agctttcgcctttccgccgtggtgcattcagagcttggtgatgaagcgatcgtactggat
tcttttttggatttgagcagcaacaaactagatgtaaggaagtcgaattttgtctga

DBGET integrated database retrieval system