KEGG   Vibrio anguillarum M3: N175_07400
Entry
N175_07400        CDS       T02823                                 

Definition
(GenBank) hypothetical protein
  KO
K11894  type VI secretion system protein ImpI
Organism
lag  Vibrio anguillarum M3
Brite
KEGG Orthology (KO) [BR:lag00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:lag02044]
    N175_07400
Secretion system [BR:lag02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   N175_07400
SSDB
Motif
Pfam: FHA Yop-YscD_cpl ThiS
Other DBs
NCBI-ProteinID: AGU57552
Position
1:1544614..1545585
AA seq 323 aa
MNLLKVSQMPLSIRIISSPDGESIAQWNQAFPDDGGDIGRAFGATLQLNDASREISSTHA
MIRKTSRGYQIMDNSTNGLYINGSDVPLGKGNQSTLSDGDVLDIGRYRLLVSCFFPETAK
AQIQQPHSDSCRLGDDPFSTESTPFIQSIPEVDEAPGFTISTTDVVGDDPFASDASVKQE
LAPHFNLDFQTAEDDPLKDSDFRTSFPNHEVMATSSFAQEESPLNHSQFAITEFKNHGQR
LQERTDKALEMALARLLSDISPNAMESMFDDLSGNGFWSRKPKYWDMYKRYFNRQVENRD
WQIKFQAYFRDAMRMQKNFEGDQ
NT seq 972 nt   +upstreamnt  +downstreamnt
ttgaatttattgaaggtcagtcaaatgcctctatcgattagaattattagctctccagat
ggtgaaagcatcgcccaatggaatcaagcatttccagacgatggcggagatatcgggcgt
gcgtttggcgcgacgctacaacttaatgacgcaagtcgtgagatttcaagtacccatgca
atgattcgtaagacctcgcgtggataccaaatcatggacaacagcaccaatggcctttac
atcaatggatctgatgtgcctttgggcaagggtaaccaatctacactaagtgatggtgat
gttcttgatattggccgctaccgattgctggtttcttgtttcttccctgaaacagcgaaa
gcgcaaatccagcagcctcactcagatagttgtcgattaggtgatgatccgtttagtact
gaatcaacaccttttattcaaagtattcctgaagtagatgaagcgcctgggttcaccatc
tcgacgacagatgtggtgggggatgacccatttgcgagtgatgcctcagttaagcaagaa
ctagcgcctcactttaatcttgattttcagacggctgaggatgacccactgaaagacagt
gattttcgtacgtcatttccaaaccatgaagtgatggcgacctcctctttcgctcaagaa
gagtcaccactgaaccactctcagtttgctatcactgagtttaagaatcatgggcagcgc
ttacaggaacgtacggacaaagcattagagatggcattggcaaggttgttgtctgacatt
tcaccgaatgcgatggagtcgatgtttgatgatttgtcgggcaacggtttttggtctcgt
aaaccgaagtactgggatatgtacaaacgctatttcaaccgacaagtagagaatcgcgat
tggcaaattaagtttcaagcgtacttcagagatgcaatgcgtatgcaaaaaaacttcgaa
ggggatcagtaa

DBGET integrated database retrieval system