KEGG   Vibrio anguillarum M3: N175_07420
Entry
N175_07420        CDS       T02823                                 

Definition
(GenBank) hypothetical protein
  KO
K11891  type VI secretion system protein ImpL
Organism
lag  Vibrio anguillarum M3
Pathway
lag03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:lag00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    N175_07420
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:lag02044]
    N175_07420
Secretion system [BR:lag02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   N175_07420
SSDB
Motif
Pfam: IcmF-related_N IcmF-related IcmF_C DUF1772 DUF4381 LPG_synthase_TM DUF4131 Peptidase_U4
Other DBs
NCBI-ProteinID: AGU57556
Position
1:1548520..1551972
AA seq 1150 aa
MFKKIFSIFLVITAILGTLAFWLTASEEQPVWIKWGMLAVTVVIVFFTCVWWWKQRKLNQ
TEKEEHDQHVLLKQDTRVIQQLFRIATKKIQGQARNKLESLYSLPWYLVLGGEKDAKSAI
LLQNGFEPVNERYLDESDTEQYLRFWSNDNAVVVEVGHRIFDNDGIDESLWQVLAKQLLK
YRPRQGLNGIVTVIGCDRLMTGDKKERTRLSGIYQEAVLSMGAELSLNLPVYAAFSKADS
IADFTGFFESFTACDSENPFGITFECDVSRRYDKQQFEAESHALIQSIAGQQFELLRNVS
SDKSGSIIAWPYQLRIFLERVNEFLSDIGRENRVREAVWIRGAYLMSSGQKGIEHDLLTQ
VVAERAEFNTNNQVEQQPNRRGFFTQRLFNKVILPEKNIVGVNEWRHAGYLVFRTAVLVS
VVGLISIAGLKLQENWNVDEDWRTTALSQIRFYQNDVQKLSNDNSMSEVVAVLRELGDVV
AEGVQPKPWHEKVSIKQTDTAESVYSAYEKQLHQIMLPKLEELISSELYVYVNLGNPSRI
FEILRYYQMLFDREQLNFAELQTYLLDNLKDQGELSPDELYSFSLLIEDLFKSQYDKQLQ
PNLDLIAVATNNLEGLSPERLIYARIKEMPEYRTQVDLRSQLGEKFDSLFEFTNDFHGYL
IPEIFTKQGYSQIDLTVKSPLLRSLMSEFKAIQGDMSGASVIELRELSKQVQRLYFSDYI
YYWKDLVNNIQIKQFGDASGLSYALRNTRSPATSPLLDVLDAVVVNTTLAVADQPDTKGQ
KRAAGQLGLKNAKKVLNKADKVNRAVGDNLLRLQPSFVVNEAFLPFSRFVNGNGKDKDTP
LEQLIVQVDEVNSFFDAALSSSNPGKSFHAYAIAHAQGSSDPIVNFRQAGSKAPNIVASW
TKSLSEQVWKQVVNGSVVYLNTQWDEQVYQFYVSAIEGRFPFDQHGRGEVSLDDFSQFFK
PSGRVARYIEETLKPFVYWDNGMLKLNEVDGLALPINSNTRKQLELVQKLSGIFFGSSGD
DLGLRLEVKASSMSTDVTEFRLREAETIYDYKHGPRVWREITWPTAGVDGYLSAEFYSGQ
NRVAQQSFTGQWALLRALFANKSSATSSRLIRKLNYKINQNNIVLDYTLRDSKQPLDKSL
FVQFSLPKQL
NT seq 3453 nt   +upstreamnt  +downstreamnt
atgtttaaaaagatattttctattttcttggtgattactgccattttagggacgctcgca
ttttggcttacagcatcagaagagcaaccagtctggataaagtggggaatgctcgctgtc
accgtcgttattgtcttctttacatgtgtttggtggtggaaacagcgcaagcttaatcaa
acagagaaagaagagcatgatcaacacgtactgcttaaacaagacacgcgtgtgatccag
cagctgtttcgtatcgcaacgaaaaagatacagggacaagctcgtaacaagctagaaagc
ctttacagtctgccttggtacctagttctaggtggtgaaaaagacgcgaaaagtgccatt
ttgctacagaatggttttgagccagttaacgagcgctacttggatgaaagtgatacggaa
cagtacctgcgtttttggagcaacgataacgcagtcgttgtagaagtcggtcatcgtata
tttgataacgacggtattgacgagtcgctttggcaggtactggcgaagcaactacttaaa
taccgtccgaggcaagggctgaacggcattgtgacggttattgggtgtgatcgcctaatg
acaggagacaaaaaagaacgcactaggctctcaggcatctatcaggaggctgtgttgtcg
atgggcgcagagcttagcttaaacttgcctgtttatgccgctttctctaaagctgactcg
atagcagacttcactggtttctttgagagcttcactgcatgtgactcagaaaatcctttt
ggtattacctttgaatgcgatgtttcacgtcgttatgacaaacagcagtttgaggcagaa
agccacgcgttgattcaatccattgcggggcagcagtttgagttactgagaaacgtcagc
agtgacaagtcgggctctattatcgcttggccttatcagctaagaattttcctagagcgc
gtcaacgagtttttgagcgacattggtcgcgagaaccgtgtccgagaagccgtatggatc
cgcggcgcttatttaatgtcatccggacaaaaaggcattgagcacgatttactaacacag
gtagtggccgaacgtgctgagttcaacaccaataatcaagttgaacagcagccaaatcgt
cgtggtttctttacgcaacgtttgttcaataaggtcatcttgccggagaagaatatcgtc
ggtgttaatgaatggcgtcatgcgggttatcttgtatttcgaaccgctgttctagtctcc
gtggttgggctgatttctattgcaggtctgaagttacaagaaaactggaatgttgatgaa
gattggcgcacaacggctctatctcaaattcgtttttatcaaaacgatgttcaaaagctg
agcaatgacaattcgatgtcggaggttgtggcggtattaagagaactcggcgacgtggtt
gctgagggcgttcaacctaaaccgtggcatgagaaagtcagtattaagcaaacagatacg
gccgagagtgtttactctgcttatgaaaaacagttgcaccagataatgctgccaaagcta
gaagagctgatcagcagcgagctgtatgtttatgtgaaccttggtaatccaagccgaatc
tttgagattttgcgttactaccagatgttgtttgaccgagagcaactgaactttgcggaa
ctacaaacttacttacttgataacttgaaagaccaaggtgagctttctccggacgagctt
tactctttttctcttttaatcgaagacctgtttaaaagtcagtacgacaagcagctacaa
ccgaacctagacctgatagctgttgcaacgaacaaccttgaaggcttgtcaccagagcga
ctgatttatgcgcgtattaaagagatgccagagtaccgtactcaagtggatctccgaagc
cagctcggtgagaagttcgatagtttgtttgagtttactaatgatttccatggctatctg
atcccagaaatctttactaagcagggctatagccaaattgatttgacggtaaagtcgcct
ctgcttagaagcttgatgagcgagtttaaagcgattcaaggtgatatgtctggcgcatca
gtcattgagcttagagaactgagcaaacaggttcaacgtctgtatttttccgattacatc
tactactggaaagacttggtcaacaacattcaaatcaagcagtttggcgatgcttcagga
ctcagctatgcactaaggaacacacgttctccggctacgagtccactacttgatgtattg
gatgcagttgtggtgaacacaacattggctgtcgcagaccaaccagatacgaaaggacaa
aagcgtgcagccggtcaactaggattgaagaacgcgaaaaaggtgttgaacaaagccgac
aaggtgaaccgagcagttggcgataacctgttgaggctgcaaccttcattcgtcgtaaat
gaagcatttttacctttctctaggtttgtgaatgggaatggtaaagacaaggatacacca
ctggagcagttgatcgttcaagttgatgaagttaactcgtttttcgatgccgcattgtct
agttcaaaccccggtaaatcattccatgcttatgccatcgcccatgcgcaaggtagtagc
gaccctatcgtgaacttccgtcaagctggtagcaaggctccaaacatcgtcgcgtcttgg
acgaagagtctcagtgaacaagtttggaagcaagtggtgaatggcagcgtggtgtatcta
aatacacagtgggatgagcaagtttaccagttttatgtgtctgccattgaagggcgattc
ccatttgatcaacatggccgtggagaagtgagcttagatgacttttctcaattctttaaa
ccaagtggccgtgtggctcgctacatagaagaaaccttgaagccgtttgtttactgggat
aacggcatgctcaagctaaacgaagttgacggcctagcgctaccaataaactcaaacact
cgtaagcaacttgaattagttcaaaaactgagtggcattttcttcggttcttcaggagat
gatcttgggttaaggcttgaagtaaaagcgagctcaatgagtactgacgtgacggaattc
cgcctacgagaggctgaaacgatttacgactacaaacatggtccaagagtgtggcgcgag
ataacttggccaaccgcaggagtggatggctatttgagtgcagaattctacagcggtcag
aatcgagtcgcacaacaatcatttaccggtcagtgggcgttgttgcgcgctctttttgcg
aataagagcagcgctacatcgagccgtttgattcgtaagctcaactacaaaattaaccaa
aacaacatcgtattggattacacgttgcgtgattccaaacaaccattggataaatcttta
tttgttcaattctcgttgcctaagcagctttaa

DBGET integrated database retrieval system