KEGG   Vibrio anguillarum M3: N175_12875Help
Entry
N175_12875        CDS       T02823                                 

Definition
(GenBank) oxaloacetate decarboxylase
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
lag  Vibrio anguillarum M3
Pathway
lag00620  Pyruvate metabolism
lag01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    N175_12875
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lag02000]
    N175_12875
Enzymes [BR:lag01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     N175_12875
Transporters [BR:lag02000]
 Other transporters
  Primary active transporters [TC:3]
   N175_12875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like Biotin_lipoyl Biotin_lipoyl_2 HlyD_D23 HlyD_3
Motif
Other DBs
NCBI-ProteinID: AGU58469
Position
1:complement(2744964..2746748)
Genome map
AA seq 594 aa AA seqDB search
MSMSKPLAITDVVLRDAHQSLFATRMRIEDMLPIAAELDKIGYWSLETWGGATFDACIRF
LGEDPWERLRSLKQAMPNTPMQMLLRGQNLLGYRHYADDVVEKFVERAHANGMDVFRIFD
AMNDVRNFEKAVKATIDVGAHAQGTLSYTTSPVHNSDTWVDLAKRLEDLGCHSLCIKDMS
GLLKPYEAEDLITRIKSSCAVPLALHSHATTGLSAATAVKAVEAGIDILDTAISSMSQTY
GHTPTETVVAMLEGTERDTGLSLTQLEPIATYFREVRKKYAKWEGQLKGVDSRILIAQVP
GGMLTNMEGQLKEQGAADRLDEVLEEIPRVRKDLGFIPLVTPTSQIVGTQAVLNVLTGER
YKSITKETAGVLKGEYGATPAPVNTELQAKVLGNLTPITCRPADLLDAEMAVLTTELLEK
AKAEGISLATDTVDDVLTYALFPQVGLKFLKNRHNPDAFEPAPTLESAKPTPATVVTKGG
IETYSVKVDGQIYTVEVGPQGQLSSISASQSQAAQSSAVPASNNAEAVPSPLAGNIFKVN
VQAGSEVLEGDVLVILEAMKMETEIRAARGGIVQDLHVKEGDAVTVGAPLLSLA
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atgagcatgtctaaaccactagctattacggatgtggtccttcgtgatgcccatcagtca
ctatttgccacgcgcatgcgtatcgaagacatgctgcctattgcagcagagctcgataag
atcggttattggtcactggagacttggggaggagcaacgtttgatgcttgcatccgtttt
ctcggtgaagatccatgggagcgtttacgttcgcttaagcaagcgatgcccaatacccca
atgcaaatgttgctacgcggccagaatttactaggctatcgccactatgccgatgatgtt
gttgaaaagtttgttgaacgagctcacgcgaatggtatggatgttttccgtatttttgat
gcgatgaatgatgttcgcaattttgaaaaagcggtcaaagcgacaattgatgttggcgca
cacgcgcagggcacactgtcttacaccactagccctgttcataattcagatacttgggtt
gatcttgccaagcggttggaagatctcggctgccactctttgtgtattaaagatatgtct
gggttgctcaagccgtatgaagctgaagatctgatcacccgtattaaatcctcttgtgcc
gtacctttagcgctgcacagccatgcaacgactggtctttcagcggcaacagccgttaaa
gcggtagaggcaggtatcgatattttggataccgctatctcgtcaatgagccaaacttac
gggcacacaccaaccgaaacagtggtcgctatgcttgaaggaaccgagcgtgatacgggc
ctgagcctgacacagcttgaaccgattgccacttattttcgtgaagtgcgtaagaaatac
gcaaaatgggaaggacagttaaaaggtgtcgattctcgtattcttattgcgcaggttcct
ggtggtatgttgactaatatggaaggtcaactaaaagaacaaggagcggccgatcgcctt
gatgaggttcttgaagagatccctcgtgtgcgaaaagatttaggtttcattccccttgtg
actccaacatctcaaatcgtgggaacacaagcggtgctcaacgtccttactggtgagcgc
tataagagcatcacgaaagaaactgcaggggtattaaaaggtgaatacggtgccacgcct
gcgccagtgaatactgagttgcaagccaaggtgttgggtaatcttacgccgatcacttgc
cgtccagccgatttgttggatgcagaaatggccgtgttgaccactgaattgcttgaaaag
gcaaaagcagagggaatttcattagctacagatacggtggatgatgttctgacttatgca
ttgttcccacaagtcggtttgaagttcttgaaaaatcgtcacaatccggatgcatttgag
cctgcgccaaccttggagtcagccaaacctacacctgccaccgttgtgacaaaaggtggt
attgaaacctacagtgttaaagtggatgggcaaatttacacggttgaagtggggccacaa
ggccagcttagctcgatttctgccagccagtctcaagcagcacagtcatcggccgtgccg
gcaagtaacaatgcagaagccgttccttcaccactcgctggcaacatttttaaagtgaat
gttcaagctggttctgaggtgttagaaggggatgtgttagtgattctggaagcgatgaag
atggaaactgagatccgtgcggcacgtggcggtattgttcaagatcttcatgtcaaagag
ggtgatgctgtgactgttggtgcaccattgctgagcttagcgtaa

DBGET integrated database retrieval system