KEGG   Vibrio anguillarum M3: N175_13435
Entry
N175_13435        CDS       T02823                                 

Definition
(GenBank) hypothetical protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
lag  Vibrio anguillarum M3
Pathway
lag03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:lag00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    N175_13435
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:lag02044]
    N175_13435
Secretion system [BR:lag02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   N175_13435
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: AGU58542
Position
1:complement(2847836..2848354)
AA seq 172 aa
MPTPCYISIEGETQGLITAGALSTDSIGDAFVEGHEDQMLVQMFDHVVTVPTDPQSGQPS
GQRVHKPFKFTVALNKAVPLLYNALASGEKMKSVELKWYRTSIEGKQENFFTTKLESASI
VDIHCEMPHCQDPANGDFTQNVTVSMSYRKILWDHVNAGTSGSDDWRKPVEA
NT seq 519 nt   +upstreamnt  +downstreamnt
atgccaactccatgttatatctctatcgaaggcgaaactcagggtctcatcactgctggc
gctctttctactgactctatcggcgatgctttcgttgaaggtcatgaagatcaaatgttg
gttcaaatgtttgaccacgttgtgacagtaccgactgacccacaatcaggtcagccttct
ggtcaacgtgttcacaaaccattcaaattcaccgttgcgctaaataaagcggttcctctt
ctttataacgcgttggcgtctggcgagaagatgaaatcggttgagctaaagtggtaccgc
acgtctatcgaaggcaaacaagagaacttcttcaccactaaacttgaaagcgcgtctatc
gtggacattcattgcgaaatgccacactgccaagatcctgcgaacggcgacttcacgcaa
aacgttacggtttctatgtcttaccgtaaaatcctgtgggatcacgtgaacgcgggtact
tcaggttcagatgactggcgcaaaccagtagaagcgtaa

DBGET integrated database retrieval system