KEGG   Vibrio anguillarum M3: N175_15500Help
Entry
N175_15500        CDS       T02823                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
lag  Vibrio anguillarum M3
Pathway
lag00260  Glycine, serine and threonine metabolism
lag01100  Metabolic pathways
lag01110  Biosynthesis of secondary metabolites
lag01120  Microbial metabolism in diverse environments
lag01130  Biosynthesis of antibiotics
lag01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lag00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    N175_15500
Enzymes [BR:lag01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     N175_15500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AGU59198
Position
2:200974..201978
Genome map
AA seq 334 aa AA seqDB search
MDFRSDTVTKPTAAMREAMANADVGDDVYGDDPTVNALEEWAAQRHGFEAALFTTSGTQA
NLLGLMSHCERGDEYLCGQQAHNYKYEAGGAAVLGSIQPQPIENNPDGTLDFDKLRAAIK
PDDAHFARTRLLSLENTINGKVLPLAYLAQARTFVDQHHLALHLDGARVYNAAVALDVDV
KEIAQYFDSMTVCLSKGLSAPIGSLLLGSKTYIAKARRLRKMLGGGMRQAGILAAAGHLA
LTEQVTQLKTDHDNAQYLARKLADLNGFSVNPDLVQTNIVFAKLADSIDIHTITNQLAQD
GIKVSPGNPVRFVTHKDVSRDDIDFLISKLSLYL
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggattttcgatcagataccgttactaaacccaccgctgcgatgcgtgaagcaatggct
aatgccgacgtgggtgatgatgtgtatggcgatgacccaaccgtcaacgccttagaagag
tgggccgcgcagcgacacggttttgaagcggcgctatttaccacgtcaggcacacaagcc
aacctgctgggtttaatgtctcattgtgagcgtggcgatgagtacctgtgtggccaacaa
gcgcacaactacaaatatgaagcgggtggcgccgcggttcttggctctattcaaccgcag
ccaatcgaaaataaccctgatggcacgttagacttcgataaactgcgcgcggccattaaa
cctgatgatgcccactttgctcgcactcgattacttagccttgaaaacaccatcaatggc
aaagttctaccactcgcctatttagcgcaagcgcgaacgtttgttgatcaacaccatttg
gcactgcatttagatggcgcgcgcgtatacaacgccgctgtagcgctggatgtggatgtt
aaagagattgcgcaatactttgactcaatgacggtctgtttatctaaagggctttccgct
cctatcggctcgctgctgttgggttcaaaaacctacattgccaaggctcgacgtttaaga
aaaatgctcggtggcggcatgcgtcaagcaggcattttggccgcagcaggccaccttgca
ttgactgaacaagtcactcagctgaagactgatcacgacaatgcccaatatttagcgcgc
aaattagcggacttaaacgggttttccgtcaatccagatttagtgcaaactaacatcgta
tttgccaaattagctgattctatcgatatccatacaattaccaatcagttggcgcaagat
ggaataaaagtttcgccaggcaatccggtacgttttgtgacccataaagacgtctcacgc
gatgatattgattttctaatcagcaaactctccctttatctctga

DBGET integrated database retrieval system