KEGG   Vibrio anguillarum M3: N175_17340Help
Entry
N175_17340        CDS       T02823                                 

Definition
(GenBank) type VI secretion protein
  KO
K11901  type VI secretion system protein ImpB
Organism
lag  Vibrio anguillarum M3
Brite
KEGG Orthology (KO) [BR:lag00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:lag02044]
    N175_17340
Secretion system [BR:lag02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   N175_17340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VipA
Motif
Other DBs
NCBI-ProteinID: AGU59519
Position
2:611038..611442
Genome map
AA seq 134 aa AA seqDB search
MVGDFKGHTEETPLEERQTVSVDKNNFEAVMRESDLKLTTTVRNKLSGDENAELPVELSF
KSLADFEPDSVAAQVPELNKLVELRQALVALKGPLGNIPAFRERLQELLNSEESREKLLS
ELSLVSGKEEEPQA
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
gtggtgggtgattttaaaggccataccgaagagaccccacttgaagagagacagaccgtt
tcagtggacaagaacaactttgaagcggttatgcgtgaaagcgatttgaaactgaccact
acagtgcgcaataaactgagtggcgatgaaaatgctgagcttcctgttgagcttagtttc
aaatctcttgctgacttcgaaccggattcagtggcagcacaagttccagaattaaataaa
ttggttgagctacgccaagctcttgtggccttaaaaggtcctttgggcaatattcccgcg
tttagagagcgtctacaagagctactaaattcggaagaatcgcgtgaaaaacttctatct
gagctcagtctagtgagcggcaaagaagaagagcctcaagcataa

DBGET integrated database retrieval system