KEGG   Vibrio anguillarum M3: N175_17365
Entry
N175_17365        CDS       T02823                                 

Definition
(GenBank) signal peptide protein
  KO
K11894  type VI secretion system protein ImpI
Organism
lag  Vibrio anguillarum M3
Brite
KEGG Orthology (KO) [BR:lag00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:lag02044]
    N175_17365
Secretion system [BR:lag02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   N175_17365
SSDB
Motif
Pfam: FHA Mod_r
Other DBs
NCBI-ProteinID: AGU59523
Position
2:616174..617646
AA seq 490 aa
MQKKQTLSMVVTNVQLLESGLSAQAMFNVQGGVIGSASDAHWQLRDGKGKIQNHHCAIRV
IDGAFCIQDLVGNTYVNGSHKPLGQGASAKLEHKDEVAIGPYQIRVIFGQVGEDDSLING
SLDQLFAKEGLDLLKDGPLDDISRDEDEPEPSSMDPIAALDDLLQGIKQEESLLEETEKP
LAQAQHSLVPEYDSQQSQLQFTPQADSEYEMTSSIRLKKILGFGKTSTDLPPIPAVEHHE
TAQPPTHLNINNSIYNVPEGLAMDDKVLDLLEEEVARSYHPHSEQHNSSSNNASHLLTGP
MLTGLGVDVGNSHDMAKMHMLSEELGQSLQACVQGLLELHQQVSEGRFGMMNRNLQPIED
NPLRLGLSYEETIRTLYDADKSVVHLSAPAAIAESLKNVRDHNEAMQHATSEALNQILNA
FSPQVLLRRFQHYKRNSDAQSNSSDAWAWEMYCHYYQELTSNRQKGFEKLFWEIFEQSYD
KKIREKQLEL
NT seq 1473 nt   +upstreamnt  +downstreamnt
atgcagaagaagcaaacgctttcaatggtagtgacgaatgtgcaactactggaatcagga
ttatccgcacaagcgatgtttaatgtgcaaggcggtgtgattggctctgcaagtgatgcg
cattggcagcttcgtgacggtaaagggaaaattcaaaatcatcactgtgcaatccgtgtg
attgatggtgcgttttgcattcaagatctggttggtaatacctatgttaatggttcccat
aagccgttagggcaaggtgcttcggctaagttggagcataaagatgaagtggccattgga
ccttaccaaattcgtgtcatttttggtcaagtgggtgaagatgattctctgattaatggc
tctttggatcagctgtttgctaaagaggggctcgatctactcaaagatggtccattggat
gatatcagccgcgacgaggatgaaccagagccgagttcaatggaccctatcgccgcttta
gatgatttattgcaaggcattaaacaagaagagtcgttgcttgaagagacggaaaaacca
ctcgcacaagcacaacattcattagtgccagaatacgatagccagcagtcgcaactgcag
tttacgcctcaagctgacagcgagtatgagatgacgtcatcgattcgattaaagaaaatt
ctcggttttggcaaaacctccaccgatttaccacctattccggctgttgagcaccatgag
actgcgcaaccaccgactcatttgaacattaataacagcatttacaacgtacctgagggc
ttagcgatggacgataaagtattagatctacttgaggaagaagtggcgagaagctaccac
cctcactccgagcaacacaacagctcgtcaaacaatgcatcacacttattgaccggcccc
atgctcaccgggctaggtgttgacgttggcaatagccacgatatggcgaaaatgcacatg
ctttcagaagagcttgggcaatcgttgcaagcttgtgtgcaaggtttgcttgagcttcac
cagcaagtgagtgaagggcgttttggtatgatgaatcgtaacttgcaaccgattgaagat
aacccacttcgcttggggctatcatacgaagaaaccattcgtactctgtatgatgctgat
aaaagtgtggtgcacttgtctgccccagcggcgattgccgaaagcctaaaaaatgtgcgc
gatcataacgaagcaatgcagcacgccactagcgaagccctaaatcagattcttaatgcc
ttttctcctcaagtgctactgcgccgtttccaacactacaagcgcaatagtgatgcacag
agtaactcttcagatgcttgggcgtgggagatgtattgccactactaccaagagctcact
tctaatcgccaaaaaggatttgagaaactgttttgggaaattttcgagcagtcttacgac
aagaaaattcgtgaaaaacagctggagctataa

DBGET integrated database retrieval system