KEGG   Vibrio anguillarum M3: N175_17380
Entry
N175_17380        CDS       T02823                                 

Definition
(GenBank) type IV / VI secretion system, DotU family domain protein
  KO
K11892  type VI secretion system protein ImpK
Organism
lag  Vibrio anguillarum M3
Pathway
lag03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:lag00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    N175_17380
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:lag02044]
    N175_17380
Secretion system [BR:lag02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   N175_17380
SSDB
Motif
Pfam: DotU
Other DBs
NCBI-ProteinID: AGU59526
Position
2:619467..620243
AA seq 258 aa
MMAIDKKNTQYSGLLFDSVEQINHDQDYWFQLRGDNPNVLIDAATPLFGLSLRVRSLSEC
ENIEQIYKQTVEEIKAIEIELAEQGFEHAILMAYRYILCAFLDEAVMGTEWGASSVWAEH
SMLSRFHSETWGGEKVFTILSRLEGEPKRYRALLEFIYQCLVLGFEGKYRVMESGHNERE
KVISRLHDTVSSLDENEPKELTSATDHVVKSKYKLSRQLPVWSVLLGFVIIWVGVFLGYS
YLLHSQSADVLNQLNQIL
NT seq 777 nt   +upstreamnt  +downstreamnt
atgatggccattgataaaaaaaacacccaatacagcggtctgctttttgacagcgtcgag
cagatcaaccacgaccaagattactggtttcaactgcgtggtgataaccctaatgttttg
attgatgctgctacccctctgtttggtttgtcgctgcgggtacgcagcttgtcagagtgc
gaaaacattgagcagatctacaaacagacggtggaagagattaaagcgattgaaatcgag
cttgccgagcaagggtttgagcatgcgattttgatggcttatcgctacattctgtgcgcg
tttttggatgaagccgtcatgggaaccgagtggggtgcatctagtgtgtgggctgaacat
tctatgctgtctcgtttccacagtgagacttggggcggcgaaaaagtgtttaccatctta
agtcgcttggaaggtgaacctaaacgttatcgcgcgttgctagagtttatctatcaatgc
ctagtgttaggttttgaaggtaaataccgtgtgatggaaagcggccacaacgagcgtgaa
aaggtgatcagtcgtttacatgacaccgtcagttcgttggatgaaaacgagccgaaagaa
ctgacctccgccaccgaccatgtggtgaaatcaaaatataagttaagcaggcagttaccg
gtttggtcagtgctgcttggttttgtcattatttgggtcggtgtgtttttaggctattcc
tatttactgcacagccaatcggcagacgtattaaaccaattgaaccaaatactctaa

DBGET integrated database retrieval system