KEGG   Vibrio anguillarum M3: N175_17390
Entry
N175_17390        CDS       T02823                                 

Definition
(GenBank) ATPase AAA
  KO
K11908  sigma-54 dependent transcriptional regulator
Organism
lag  Vibrio anguillarum M3
Brite
KEGG Orthology (KO) [BR:lag00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lag03000]
    N175_17390
Transcription factors [BR:lag03000]
 Prokaryotic type
  Helix-turn-helix
   Other families
    N175_17390
SSDB
Motif
Pfam: Sigma54_activat Sigma54_activ_2 AAA_5 HTH_8 Mg_chelatase AAA AAA_2 RWP-RK T2SSE MCM
Other DBs
NCBI-ProteinID: AGU59528
Position
2:622882..624450
AA seq 522 aa
MIMSHWLAYATELVVARKPSQLAALFVETLRRELRLDTCLLLVPSSDGRTLVPQDNPLNL
SWSVTDFDCPFAHVLQSAKSMHLTADELVFWQSNRLFSQLTSRVGMLDSVVVHPLPNGDT
QVQSILLLIGETHTLEGLFEQPDFIKYVDVFCHQWSLLNEMQREEQNRQSLSESLSDVQR
DNARRSLIASLSETLIGNSLAMKKLREQIINAAPSQLSVMVQGETGTGKELVAQAVHQLS
PRKQAPFVAINCAAIPENLLESELFGYCKGAFSGADSDKQGLIAQADGGTLFLDEIGDMP
LSLQAKLLRVLESRSFRPIGGKNEQSSDFRLVSATHVNLLEQVRNKSFRQDLYYRLFQYP
ITLPRLAARMDDIERLSQHFVRSFNQQHATNIRGVHYKAIDCLKRYDFPGNVRELKHLIE
FGCAQTLDGTQVEESCFTQRLAYTKADQQPETERHGHKVAKAEPGVSRVVDDLKQAVNEF
ESRIIRERLQYFAGDRAKAAQSLGIPKRTLAYKCQKLEIKTP
NT seq 1569 nt   +upstreamnt  +downstreamnt
gtgatcatgagtcactggttagcttacgcaaccgagcttgttgtcgcgagaaagcctagc
caattggccgcattgtttgtagaaacgctgcgccgagagctaaggctcgatacttgcttg
ttactggttcccagttcagacggccgtaccttagtgccacaggataacccgctgaattta
agctggtcggtcaccgattttgattgtccgtttgcccatgtattgcaatcggccaaatcg
atgcacttaaccgctgatgaattggttttttggcaatctaatcgcctgtttagtcaactc
actagccgggtcggcatgctagatagcgtggttgtacacccgttaccgaatggggataca
caagttcagtctattttgctgttgattggtgaaacccataccttggaaggcctatttgag
cagccagattttatcaagtatgtggatgttttttgccatcagtggtcgttgcttaatgag
atgcaacgggaagaacaaaatcgacaaagcttatcggaatccttgtctgacgttcagcgt
gacaatgctcgtcgctcattaattgcgagcctctctgaaaccttaatcggtaacagtttg
gcgatgaaaaaattaagagagcagatcatcaacgccgcgccatcacagctttcagtgatg
gtgcaaggtgaaactgggacaggtaaagagttggtcgcgcaagcggtgcaccaactctcg
ccccgtaaacaagcgccatttgttgctattaactgcgcggctatccctgaaaacttattg
gaaagtgaactgttcggctactgcaaaggggcgttttccggcgcggatagcgataaacaa
gggttgattgcgcaagccgatggcggaaccctgtttttggatgaaatcggtgatatgccc
ttgagcctgcaagccaaattactgcgggtgttggaatctcgatcttttcggccgattggc
ggtaaaaacgaacaatcttctgattttcgtttggtttcagcaacgcatgtcaatctcctc
gaacaagtgcgtaataaatcgtttcgtcaggatctttattaccgcttatttcagtacccg
atcactttgccacgccttgcggcaaggatggatgacattgaacggcttagccaacatttt
gtgcgcagctttaatcagcagcatgcaaccaacattcggggtgtgcactataaagcgatc
gattgcctaaaacgttatgactttcccggtaacgtgcgtgaactcaagcaccttattgaa
tttggttgtgcgcaaacactggatggcacacaggtggaggagtcctgctttacacaacgt
ttagcatacactaaagccgatcagcagccagagactgaacgacatgggcataaggtcgct
aaagctgagcccggtgtcagccgagtggtggatgatttaaaacaagcggtgaatgaattt
gagtctcgtattatccgtgagcgcctccaatactttgctggtgatagggccaaagcggcc
caaagcctcggtattcccaagcggaccttggcctataaatgccaaaaattggagattaaa
acaccatga

DBGET integrated database retrieval system