KEGG   Vibrio anguillarum M3: N175_17400
Entry
N175_17400        CDS       T02823                                 

Definition
(GenBank) type VI secretion protein
  KO
K11910  type VI secretion system protein VasJ
Organism
lag  Vibrio anguillarum M3
Brite
KEGG Orthology (KO) [BR:lag00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:lag02044]
    N175_17400
Secretion system [BR:lag02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   N175_17400
SSDB
Motif
Pfam: T6SS_VasJ ImpA_N TraF_2
Other DBs
NCBI-ProteinID: AGU59530
Position
2:625116..626513
AA seq 465 aa
MELTDYRRCITQPIQADNPVGERLIDDPLFDFVEDQMMKVGSLSHASVQWDEVEHSTLKL
LSGKSKDLKLLIYLLQCLHNQVTPLRFTTSLQLLSDFMSLYWEDCFPAPGKRGSLPRRKF
FSQIVQRLALVIDKLDFAQFDGPDRDELNTAIDALQQATTQAGLMSESVESLVAKVQAQL
RRATEREQATQHVQETPAVERKTTTQSAISVDSSSDKATKQTLLKVAEFLSEQEFGIALA
IRVRRFAVWSSITSLPEHDVSGETLLRAMAQERIKEYHDQMRSPDLALWRKVEQSLTMAP
YWFEGQMMSYQIAQSLGQKAWSEAILSESQQFVARLPALLELKFKGGEPFVNASVKEWLL
SQQQSSAQGQVAGDWQDKRKEAFSLAKEGGIAVALSMLNDGLVSASEPRDKFYWRLLSAD
LLNSNNLDAMAKEQYQTLHAQVSTMSVTDWEPSLVEQLEQYTTSE
NT seq 1398 nt   +upstreamnt  +downstreamnt
atggagttaaccgattatcgccgctgtattactcagcctattcaagccgataaccctgta
ggtgagcgcctgattgatgatccactgtttgattttgttgaagatcaaatgatgaaagtg
gggtcactctcccacgctagcgtgcaatgggatgaagtcgaacacagtacgctcaaactg
ctcagcggaaaaagtaaagatctcaaattattgatctacttgttgcagtgtttgcataac
caagtcacaccgctacgtttcaccacgtcgctgcagctgctgagcgatttcatgtccctt
tactgggaagattgcttccctgcgccaggcaaaagaggcagtttgccacgtcgcaaattc
ttcagccagattgtgcagcggttagccttggtcatcgacaagttagatttcgcacaattt
gatggaccagatcgtgatgagttaaacaccgcgatcgacgcgctacagcaagcgactact
caagccggactgatgtctgaaagcgttgaaagtctagtagctaaagttcaagcccaactg
cgccgcgcaacagaacgtgagcaagcgactcaacatgtgcaagagactccggcggttgaa
cgtaaaaccaccacccagagcgccatctcagtcgacagttcaagtgacaaagccactaag
cagaccttactaaaggtagctgagtttttgtctgaacaagagttcggcattgccttggca
atacgagtcaggcgttttgccgtgtggtcaagtattacctcattacctgagcacgacgtc
agcggtgaaacactgttacgggcgatggcgcaagaacgaatcaaagagtatcacgaccaa
atgcgtagcccagatttagccttatggcgcaaggtagagcagagtttgaccatggcacct
tactggtttgaagggcagatgatgagctatcaaatcgcgcaaagcttaggccaaaaggcg
tggagtgaagccattttgagtgaaagccagcagtttgtggcacgtctacctgcgctgctc
gagttgaaattcaaaggaggcgagccttttgtcaatgcgagcgtaaaagagtggctactc
agccagcagcaaagtagtgcccaaggccaagtagcaggtgattggcaagacaaacgcaaa
gaggcgtttagcttagcgaaagagggaggcattgcggtggcgctctctatgctcaacgat
ggtctggtcagcgccagtgagccaagggataaattctattggcggttattatcggctgat
ttgttaaatagcaataatttagatgcgatggcgaaagaacagtaccaaacgttacatgct
caggttagcaccatgagcgttaccgattgggaaccctcattagttgagcaattagaacaa
tacacaacgtcagagtaa

DBGET integrated database retrieval system