KEGG   Vibrio anguillarum M3: N175_17415
Entry
N175_17415        CDS       T02823                                 

Definition
(GenBank) type IV secretion protein Rhs
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
lag  Vibrio anguillarum M3
Pathway
lag03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:lag00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    N175_17415
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:lag02044]
    N175_17415
Secretion system [BR:lag02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   N175_17415
SSDB
Motif
Pfam: Phage_GPD Phage_base_V DUF2345 DUF2917 Phage_Mu_Gp45
Other DBs
NCBI-ProteinID: AGU59533
Position
2:631561..633645
AA seq 694 aa
MLFCDKRVEGKKMARLSFRLTVEGLADDTLVVHEYQGVESLSDSTQAGLRCYGFRYEIKL
ASRQSGLTALELVDKTAQLEILRDDLVVQRVHGIVRQFSKGDIGHHHTFYSLTLVPALER
LSLRQNSRIFQLKTVPEILSIVLQEMGINDYAFSLKRECAQREFCVQYRETDIDFLHRLA
AEEGLVYHFIHEEGKHTLFFSDDSQSLTKRETPIPYNVLAGGVMESPYVSQLTQHSQTEV
SHSALQDYSFKKPSYSFAQQAQGREMDYQQATYEHFDAPGRFKDDISGKAFNQIRLEYLR
REARTATGKSNHPGLQAGTKFDLQEHLDDSANRDWVVVQVHHQGQQPQALEEEGGSGATT
YSNQFTLIPADVTWRATPQAKPQVDGPCMALVVGPDGEEIFCDEHGRVKLHFPWDRYSNG
DEHSSCWVRVSQGWAGSQYGMIAIPRIGHEVIVSFLNGDPDQPIVTGRTYHATNKAPYAL
PDNKTKTVLRSETHQGEGFNELSFEDQAAQEKIYLHAQKDLDALVLNDATAHIKHDQHLT
VDNDQFTHVKHNQHLTVEGESRESVKGSCILMVDGSLHVKSGQVWTNESGDEIHIKAGQK
VVIEAGSEITVTAGGSFVKVDPAGVHLSGAGVNLNSGGSAGSGSGFSGDLPLLPGELELQ
KSPAPPQTILYQALLQAEEARVPAVKVCPLAGDA
NT seq 2085 nt   +upstreamnt  +downstreamnt
gtgttattttgcgataaaagagtggaagggaaaaagatggcaaggttaagttttaggctc
accgtggagggtttggcagacgacacgttagtggtgcatgaataccaaggtgtggaatcg
ctgtctgatagcacgcaagcgggcctgcgctgctacggttttcgctatgagataaaactg
gccagtcgtcaatctggcttaacggcactggagctggtggacaaaaccgctcagcttgag
atactgcgtgatgaccttgtcgtgcagcgcgtgcacggcattgtgcgccagttcagtaaa
ggcgatattggccatcatcacaccttttactcactgaccttagtcccggcattagagcgg
ttatcactgcgccaaaacagccgcatcttccagctcaaaaccgttcccgaaatcctctcc
atcgtactgcaagaaatgggcattaacgactacgccttctcgctgaagcgcgagtgtgca
cagcgtgaattctgcgtgcagtaccgtgagacggatatcgacttcttgcaccgcttagcc
gccgaagaaggcttggtgtatcacttcattcatgaagaggggaaacacaccctctttttc
agtgacgacagccaaagcctgacgaagcgagaaacgcctatcccttacaacgtccttgcg
ggtggcgtgatggagagcccttatgtgtcgcaattaacgcaacacagccaaaccgaagtg
agccacagcgcgctgcaagattacagctttaaaaagccgagctactcgtttgcccagcaa
gcgcaagggcgcgaaatggattaccagcaagcgacctacgagcactttgatgcaccgggt
cgctttaaagacgacatcagcggcaaagcctttaatcaaattcgcttagagtacttacga
cgagaagcgcgtaccgcgaccggaaaaagtaaccatccgggcctgcaagcgggcacaaag
ttcgacttacaagagcatcttgacgacagcgcgaaccgcgattgggttgtcgtgcaagtg
catcatcaggggcagcagccacaagcattggaagaagagggcggcagtggcgcgaccacg
tacagcaaccaattcacgctcattcctgctgatgtcacgtggcgtgcgacaccgcaagcc
aaacctcaagtggatggcccttgcatggcattggtggtggggcctgatggcgaagaaatc
ttctgtgacgaacatggccgcgtcaaactgcatttcccgtgggacagatattccaacggc
gatgaacacagctcatgctgggtgcgcgtctcacaaggttgggctggcagccaatatggc
atgatagccattccgcgcattggtcatgaagtcatcgtctcgtttcttaacggcgaccca
gaccaaccgatagtgacaggccgtacctaccatgcgaccaataaagcgccgtacgcactg
ccggataacaaaaccaaaaccgtgctgcgcagtgaaacgcaccaaggagaagggtttaac
gagctgagttttgaagaccaagcagcgcaagagaaaatctacctacacgcgcaaaaagac
ttagacgccttggtgctcaatgacgccacggcgcacatcaagcacgaccagcacctcacg
gtggataacgaccaattcacgcacgttaaacataaccagcacctcacggtggagggcgaa
agccgcgaatcggttaagggtagctgtatattaatggtcgatggttccttgcacgtaaaa
tcagggcaagtttggactaatgaaagtggagatgaaatccacatcaaagctggacaaaaa
gtggtgattgaagcagggtcagaaattaccgtgacagccggtggcagttttgtcaaagtc
gatcctgctggtgtccatctttctggggcgggcgttaatttaaactcaggcggaagtgcg
ggcagtggcagtggttttagtggcgatttaccgttattacctggtgagcttgaactgcaa
aaatcccccgcgccacctcaaaccattctttaccaagcgctattgcaagctgaagaagca
cgagtgccagccgtaaaagtatgcccattagccggggatgcctaa

DBGET integrated database retrieval system