KEGG   Vibrio anguillarum M3: N175_18450
Entry
N175_18450        CDS       T02823                                 

Definition
(GenBank) hypothetical protein
Organism
lag  Vibrio anguillarum M3
SSDB
Other DBs
NCBI-ProteinID: AGU59702
Position
2:890092..890826
AA seq 244 aa
MKFIANTNRKKRISIIVLFIALFFLGSDYYQTSQPNILGDEPDESYITISGKKPIDAYLE
VWTHFWVTGDECEAYSYDLFGQKSHKGGKISQKITHNFAKDDSRYEFRIPYQTYKNEQNC
IVELRDFSIQAYNKFDTVGFAQLRVSPAGNEYYNRSIELGSSIEAKNCRARYYEDLDEWS
TGLACSFYTNGKMKDKKDLVEFNAYTAYYDFSKFNNDTVIHYDILAGENYRSEPLVQEQV
AVAQ
NT seq 735 nt   +upstreamnt  +downstreamnt
gtgaaatttatcgctaatactaataggaaaaaaagaatatcaattattgtactattcatc
gcattatttttccttgggtctgattattaccagacttctcaaccgaatattttgggtgat
gaacctgatgagtcctatattactatatcaggcaaaaagcctatagatgcttatttagaa
gtttggactcatttttgggtgacaggagatgagtgcgaggcttattcctacgatttattt
ggtcaaaaatcccataaaggaggaaagataagccaaaaaattacgcataattttgctaaa
gatgattcacgttatgaatttaggatcccttaccaaacgtataaaaatgaacaaaattgt
atagtggaattaagagacttttccattcaagcatacaacaaatttgatactgttggtttt
gcccagttacgagtttcaccagcaggcaatgaatattataatagatcaattgagcttggt
tcttctattgaagcaaaaaactgtagagcaagatattacgaagacttagatgaatggtct
acaggcttggcttgcagtttttatactaatgggaaaatgaaagataaaaaagatttagtc
gaatttaacgcttacaccgcctactacgatttctcgaaatttaataacgacactgtgatt
cattacgatattttagccggtgagaattaccgctctgagccgttagtgcaagaacaagtc
gctgtagcgcaataa

DBGET integrated database retrieval system