KEGG   Labrenzia aggregata: B0E33_03960Help
Entry
B0E33_03960       CDS       T04723                                 

Definition
(GenBank) sugar ABC transporter ATP-binding protein
  KO
K10820  galactofuranose transport system ATP-binding protein [EC:7.5.2.9]
Organism
lagg  Labrenzia aggregata
Pathway
lagg02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:lagg00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    B0E33_03960
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lagg02000]
    B0E33_03960
Enzymes [BR:lagg01000]
 7. Translocases
  7.5  Catalysing the translocation of carbohydrates and their derivatives
   7.5.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.5.2.9  ABC-type D-galactofuranose transporter
     B0E33_03960
Transporters [BR:lagg02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Galactofuranose transporter
    B0E33_03960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_23 AAA_29 AAA_30 RsgA_GTPase AAA_22 AAA_16 MMR_HSR1 AAA_33 DUF815
Motif
Other DBs
NCBI-ProteinID: AQQ07123
Position
829973..831487
Genome map
AA seq 504 aa AA seqDB search
MASVTDPVLECRGISKFFPGAIALDAVDLTLYPGEVHALLGENGAGKSTLIKCLTGAYRR
DAGTILLNSQEISPNSTQDSQKLGIGTVYQEVNLLPNLTVAENLFLGRQPMWHGFISQRK
MMKMARDLLAEFGLSVNPAEPLSAYSVAVQQVVAIARAVELSGKVLILDEPTASLDRDEV
DLVFSVIEKLKARGLAIVFITHFLDQVFEISDRATVLRNGRVVGTRLLADATQTEIVTLM
LGRQLEDRIHDRAPSATGDTLIELTNFGKRGMITPFDLTVRKGEVVGLAGLLGSGRTETA
EIIFGAVQADQGEALLEGKKVTIKNPREAVAHRFALCPEDRKSDGIVGDLSVRENIILAL
QARQGWFRPLPKAKVNELAEAYVKALDIRLASLDMPIRLLSGGNQQKALLARWLATNPAF
LILDEPTRGIDVGAHAEIIALIEKLREDGMALLVASSELEELVAYSTRVIVLRDRRQVCE
LAGDDITTSNIVAAIADEPMAEAV
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcgtaaccgaccctgtgctcgaatgccggggcatatccaaattctttccgggg
gccatagcgctggatgcagtggacctgaccctttatccgggtgaagtgcatgcgctgctc
ggcgaaaacggggccggaaaatccaccctgatcaaatgcctgaccggtgcctatcggcgc
gatgccggcaccatcctcctgaacagtcaggaaatctcgcccaacagcactcaggacagc
cagaaactgggtatcggcaccgtctaccaggaagtgaatctgctgccgaacctgactgtt
gcggagaacctttttctcggccgccaaccgatgtggcacgggttcatttcccagcgcaag
atgatgaagatggcgcgggatctgcttgccgaattcggcctctccgtcaatccggccgaa
ccgctgtcggcctattccgtcgccgtacaacaggtggtcgcgattgcccgtgccgtcgag
ctttccggcaaggttctgatccttgacgaaccgacagccagcctcgaccgggatgaggtc
gaccttgttttttccgtcattgaaaaactgaaggcgcgtggtctcgccattgtcttcatc
acgcatttcctcgaccaggtgttcgagatctccgaccgtgcaacggtgctgagaaacggc
cgtgtggttggcacccgtctgcttgcagatgcaacccagaccgagatcgtgacgctgatg
ctcggccggcagctggaagatcgcattcacgaccgcgccccgtcggcaaccggtgacaca
ttgatagagctgacgaacttcggcaaacgcggcatgatcacgccgtttgacctgaccgtg
cgcaagggcgaagtcgtcggacttgccgggcttctggggtccggacgtacggaaactgcc
gaaatcatctttggcgccgtgcaggctgaccagggcgaagcgctgctggaaggcaagaaa
gtcaccatcaagaacccgcgtgaggccgtcgcgcaccggtttgcgctctgtccggaagac
cggaagagcgacggtatcgtcggcgatctttccgtgcgggagaatatcattctggctctg
caggcccgacagggctggttccggccactaccgaaggcaaaggtcaacgaactggcggaa
gcctatgtgaaggccctcgacattcgcctcgccagtctggacatgcctatccgcctgctt
tctggcggtaatcagcagaaggcactgctggcaagatggctggcgaccaatccggccttc
ctcatcctggatgaaccgacacgcggcattgatgtcggcgcccacgcggaaatcatcgcc
cttatcgagaaactgcgcgaagacggcatggcgcttcttgtggcctcgtccgagctggaa
gaactcgtcgcctattccacccgggtgatcgtgctgcgtgaccggcgtcaggtatgcgaa
cttgccggtgacgacatcacgacttccaacattgtcgcggccattgccgacgaacccatg
gcggaggctgtttga

DBGET integrated database retrieval system