KEGG   Labrenzia aggregata: B0E33_11535Help
Entry
B0E33_11535       CDS       T04723                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lagg  Labrenzia aggregata
Pathway
lagg00071  Fatty acid degradation
lagg00072  Synthesis and degradation of ketone bodies
lagg00280  Valine, leucine and isoleucine degradation
lagg00310  Lysine degradation
lagg00362  Benzoate degradation
lagg00380  Tryptophan metabolism
lagg00620  Pyruvate metabolism
lagg00630  Glyoxylate and dicarboxylate metabolism
lagg00640  Propanoate metabolism
lagg00650  Butanoate metabolism
lagg00900  Terpenoid backbone biosynthesis
lagg01100  Metabolic pathways
lagg01110  Biosynthesis of secondary metabolites
lagg01120  Microbial metabolism in diverse environments
lagg01130  Biosynthesis of antibiotics
lagg01200  Carbon metabolism
lagg01212  Fatty acid metabolism
lagg02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lagg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    B0E33_11535
   00630 Glyoxylate and dicarboxylate metabolism
    B0E33_11535
   00640 Propanoate metabolism
    B0E33_11535
   00650 Butanoate metabolism
    B0E33_11535
  09103 Lipid metabolism
   00071 Fatty acid degradation
    B0E33_11535
   00072 Synthesis and degradation of ketone bodies
    B0E33_11535
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    B0E33_11535
   00310 Lysine degradation
    B0E33_11535
   00380 Tryptophan metabolism
    B0E33_11535
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    B0E33_11535
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    B0E33_11535
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    B0E33_11535
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lagg04147]
    B0E33_11535
Enzymes [BR:lagg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     B0E33_11535
Exosome [BR:lagg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   B0E33_11535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AQQ04140
Position
complement(2471832..2473031)
Genome map
AA seq 399 aa AA seqDB search
MTQTRKAVIAAARRTAVCPRGGALALFQTDELAAPVLAQLVVDAGIEPEEVDCVFLGNAL
YGGGNPARLAALRAGLPQTVPALTIDTQCCSGLDAIVMGARLIEAGAADIVLAGGAESFS
RSPIRMIRPVDPEVPPVAYDRPAFAPAPFGDPDLADAAARLAAETGTSREDQAVFAVTSH
DKARSARGYLRGRLVNAGGKLPEEDGFTRHLSLKTALRAPLLNGDNETGLSAATIACEAD
GAAAVLLMSEGAFQERFHLYSSESRKSGLKILASRSAGGNPAEPALVPIEVAKAMFAELG
MDATELAATELMEAYAVQAMATAAPLGLESEGLNRMGGALARGHPIGASGAILAVHLFEV
LTRKETPAEGARNVGMALIAAAGGLGSGIVVSPAVRKGG
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcagacacgcaaggcagtgatcgcagcagcacggcggacggcggtttgcccgcgc
ggtggcgcacttgccttgtttcagaccgacgagcttgccgcacccgttcttgcacagctt
gtcgttgacgccggaatagagccagaagaggtcgactgcgtctttctgggcaacgctctt
tatggcggcggcaatccggcccgccttgccgcgcttcgcgccgggttgcctcaaacggtt
cccgctctcaccatcgatacgcagtgctgctcgggacttgatgcgatcgtcatgggcgca
agattgatcgaggcaggtgcggcggacattgttctggcaggaggagcggaaagcttcagc
cggtcgccgatccggatgatcagacctgtcgatccggaggtaccgcccgttgcttacgac
cgtcctgcttttgcgcccgcgccattcggcgacccggatcttgcagatgcagctgcaagg
ctcgccgctgaaacgggaacatcgcgagaagaccaggcggtctttgctgtgacctcacac
gacaaggcgaggtcggcaaggggctatcttcgcggacgtctggtcaatgccggagggaaa
cttccggaagaggacgggttcacgagacacctgtcgctcaagacagccctcagggcaccg
cttctgaacggagataacgaaaccggtcttagtgccgcaacgatcgcctgcgaagcagac
ggcgctgccgcggtattgctgatgtccgagggagcctttcaagaacgctttcatttgtat
tcaagtgagagccggaagtcaggcctgaaaatacttgcgagccgaagtgccggcggtaac
cccgccgaaccggctctggttccgatagaggtggcgaaggccatgttcgcagaactgggt
atggatgcgacggagctggctgctacagaactcatggaagcctatgcggttcaggcaatg
gcgacagcagcgcccctgggtcttgaatctgaaggtctgaaccggatgggcggcgcactt
gcaagagggcatccgatcggcgcatcaggcgcaattctggctgtgcacctgtttgaagtg
ctgacacgcaaggagacccctgcggaaggtgcccggaacgtaggcatggcgctcattgcg
gcagctggtggactaggctcggggatagtggtttcgcctgctgtgcgcaaaggtggataa

DBGET integrated database retrieval system