KEGG   Labrenzia aggregata: B0E33_21845Help
Entry
B0E33_21845       CDS       T04723                                 

Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
lagg  Labrenzia aggregata
Pathway
lagg00030  Pentose phosphate pathway
lagg00480  Glutathione metabolism
lagg01100  Metabolic pathways
lagg01110  Biosynthesis of secondary metabolites
lagg01120  Microbial metabolism in diverse environments
lagg01130  Biosynthesis of antibiotics
lagg01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lagg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    B0E33_21845
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    B0E33_21845
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lagg04147]
    B0E33_21845
Enzymes [BR:lagg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     B0E33_21845
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     B0E33_21845
Exosome [BR:lagg04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   B0E33_21845
  Exosomal proteins of colorectal cancer cells
   B0E33_21845
  Exosomal proteins of bladder cancer cells
   B0E33_21845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N DUF4460
Motif
Other DBs
NCBI-ProteinID: AQQ05883
UniProt: A0A0M6Y0M6
Position
complement(4704603..4706078)
Genome map
AA seq 491 aa AA seqDB search
MAVRVIEVEEFDLVVFGASGDLAHRKLLPALYHRDADGQMPENARIICSARRDYSDDDYR
DYAKAALEEHVKDLDDEHLQQFLKRLRYVKIDIATGDGFEDLRTILDERPEVIRAFYLAV
GPDLFGTICENLGRIGVVNDHSRVVMEKPIGKDGKSARALNDTVGAVFNEHQIFRIDHYL
GKETVQNLMALRFANALFEPLWNAAHIDHVQITVAESLGTGGRAGYYDTAGALRDMVQNH
ILQLLCLVAMEPPESMNADSVRDEKLKVLKALAPIDEQSIDKLTVRGQYRAGASAGGAVP
GYLEELGNNESRTETFVALKAEIANWRWAGVPFYLRTGKRLAQRVSEIVVQFRPIPHSIF
DAEAGAITANRLIIRLQPDEGVQMQIMIKDPGPGGMRLRQVPLDMSFAEAFKVRNPDAYE
RLIMDVIRGNQTLFMRRDEVDAAWAWIDPIQAAWAASKETPKGYTAGTWGPSASIALVER
DGRTWAEDDSN
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggcggtacgcgtcattgaagttgaagaattcgacctcgtcgttttcggagcctccgga
gacctcgcccaccgcaagcttctgcctgccctttaccaccgcgacgcggacggccagatg
ccggaaaacgcccgcatcatctgcagtgcccgccgggactattccgacgacgactatcgc
gactatgccaaggccgcgcttgaagaacacgtcaaggatctggacgacgagcatcttcag
cagttcctgaagcgcctgcgctacgtcaagatcgacatcgccacaggcgacggctttgaa
gatctgagaaccatcctggacgaacgccctgaagtcatccgcgccttctatcttgcagtc
ggcccggatctcttcggcacgatctgcgagaacctgggccggatcggcgtcgtcaacgac
cattcccgcgtcgtcatggaaaagcccatcggcaaggacggcaagtccgccagggcactc
aacgacacggtcggcgctgtgttcaacgaacaccagatcttccgtatcgaccactatctc
ggcaaggaaacggtgcagaacctgatggccctgcgctttgccaatgccctgttcgagccg
ctgtggaacgcggcccatatcgaccacgtccagatcaccgtggccgagtcgctcggcacc
ggcggccgtgccggctactacgacactgcgggtgccctgcgcgacatggtgcagaaccac
atcctgcagctgctctgccttgttgcgatggagccgccggaaagcatgaacgccgacagc
gtgcgcgacgagaagctgaaagttctgaaagctcttgccccgattgacgagcagagcatc
gacaagctgaccgtgcgcggccagtaccgcgcaggggcttcggccgggggtgcggttccc
ggttacctggaagagctcggcaacaacgaaagccggacggaaaccttcgtcgccctgaag
gcggaaatcgccaactggcgttgggccggcgtgcccttctacctgcgcaccggcaagcgt
ctggcgcagcgtgtatcggaaatcgtcgtccagttccgcccgatcccgcattcgatcttc
gacgcggaagccggggcgatcaccgccaaccgcctcatcatccgtctgcagccggatgaa
ggcgtccagatgcagatcatgatcaaggaccccggccccggcggcatgcgcctgcgtcag
gttccgctcgacatgagttttgccgaagccttcaaggtgcgtaacccggatgcctacgaa
cgcctgatcatggacgtgatccgcggcaaccagaccctgttcatgcgccgtgacgaagtt
gacgccgcctgggcgtggatcgacccgatccaggctgcatgggcagcctctaaggaaacg
ccgaaaggctacaccgccggcacctggggtccgtccgcctccatcgctctggtcgagcgt
gacggccgcacctgggccgaagacgacagcaactga

DBGET integrated database retrieval system