KEGG   Labrenzia aggregata: B0E33_30060Help
Entry
B0E33_30060       CDS       T04723                                 

Definition
(GenBank) fuconate dehydratase
  KO
K18334  L-fuconate dehydratase [EC:4.2.1.68]
Organism
lagg  Labrenzia aggregata
Pathway
lagg00051  Fructose and mannose metabolism
lagg01100  Metabolic pathways
lagg01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lagg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    B0E33_30060
Enzymes [BR:lagg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.68  L-fuconate dehydratase
     B0E33_30060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MR_MLE_C MR_MLE_N MAAL_C PepSY
Motif
Other DBs
NCBI-ProteinID: AQQ08033
Position
unnamed1:complement(367229..368524)
Genome map
AA seq 431 aa AA seqDB search
MTTITGLKTYDLRFPTSETLDGSDAMNPDPDYSAAYVVLQTDDDGLEGHGLTFTIGRGND
ICVAAIEAMRHLVTGLDLAWISENPGRFWRHVTSDSQLRWIGPDKGAMHLATGAVVNAVW
DLLAKQAGKPVWRLVADMSPEEIVSIIDFRYLTDAITPEEALAILKAAEPGKAERIAQLE
AHGYPCYTTSAGWLGYPDDKLRRLCREAVEAGYTHVKLKVGRDLADDIRRLRIAREELGP
DRFLMIDANQVWDVGQAIDWVQQLAFAKPYFIEEPTSPDDIAGHRAIREAVAPVKVATGE
MCQNRIVFKQMIAGGAIDIVQIDACRMGGLNEVLSVLLMAAKFGTPVWPHAGGVGLCEYV
QHLSMIDFVAVSGTREGRVIEYVDHLHEHFVDPCTIRNAAYMPPQMPGFSVEMKPASIEH
HIFRDGSAGAA
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
gtgacgacaatcaccggtctgaagacgtacgatctccgctttccgacgtccgaaaccctt
gacggttcggacgccatgaaccccgatccggactattccgcggcctatgtcgttcttcaa
accgacgacgatggccttgaaggacatggcctgaccttcactatcgggcgcgggaatgac
atctgtgttgccgcaatcgaggccatgcgccacctggtgacagggcttgatcttgcctgg
atctccgaaaaccccggccgcttctggcgtcacgtgacctcggacagccagttgcgctgg
atcggaccggacaagggcgccatgcatctcgccaccggcgccgtcgtcaatgccgtctgg
gaccttttggccaaacaggccggcaaaccggtctggcgtcttgtcgcggacatgagcccg
gaagagatcgtttccattattgatttccgctacctgaccgatgcgatcacgccggaagag
gcacttgccatcctgaaagcggcggaaccgggcaaggcggaacggatcgcgcagctcgaa
gcacatggctatccctgttataccacctcggcgggctggctcggctatcccgacgacaag
ctgcgccggctgtgccgggaagcggtcgaggctgggtatacccacgtaaaactcaaggtc
gggcgcgatctcgccgatgacatccgccggctgaggatcgcccgggaggagctcgggccc
gaccggttcctcatgatcgatgccaaccaggtgtgggacgtcggacaggccatcgactgg
gtacaacaactcgcgtttgccaaaccctacttcatcgaagaaccaaccagcccggatgac
atcgccggccatcgcgcgatccgcgaagcggtggcgccggtgaaggtggcaaccggtgaa
atgtgccagaaccggatcgtcttcaagcagatgattgcaggcggtgccatcgacatcgtg
cagatcgacgcctgccggatgggcggtctcaacgaggttctcagcgttctgctgatggca
gccaaattcggcactcccgtctggccgcatgccggcggcgtcggtctttgcgagtatgtg
cagcatctgtcgatgatcgacttcgttgcggtttccggaaccagggaagggcgcgtgatc
gaatatgtcgatcatctccacgaacatttcgtcgacccctgcaccatccgcaatgccgcc
tatatgccgccgcagatgccgggcttttccgtggagatgaaaccggcctccatcgaacat
cacatctttcgagacggtagcgcaggcgccgcctga

DBGET integrated database retrieval system