KEGG   Lactobacillus amylophilus: LA20533_01660Help
Entry
LA20533_01660     CDS       T05031                                 

Definition
(GenBank) alanine--tRNA ligase
  KO
K01872  alanyl-tRNA synthetase [EC:6.1.1.7]
Organism
lah  Lactobacillus amylophilus
Pathway
lah00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:lah00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    LA20533_01660
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lah01007]
    LA20533_01660
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lah03016]
    LA20533_01660
Enzymes [BR:lah01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.7  alanine---tRNA ligase
     LA20533_01660
Amino acid related enzymes [BR:lah01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   LA20533_01660
Transfer RNA biogenesis [BR:lah03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    LA20533_01660
 Prokaryotic type
    LA20533_01660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2c tRNA_SAD DHHA1 DUF5497 Bacillus_HBL Cas_Csy4 UPF0242 DUF3659 DUF4407
Motif
Other DBs
NCBI-ProteinID: APT18065
UniProt: A0A0R1YS67
Position
complement(294559..297201)
Genome map
AA seq 880 aa AA seqDB search
MKQLSSAEIRQMFLDFFKSKNHMVEPSSSLIPKDDPTLLWINSGVATLKKYFDGSVIPKN
PRITNAQKSIRTNDIENVGKTARHHTFFEMLGNFSVGDYFKEDAIPWAWEFLTSPKWLDF
DPAKLYVTVYPKDTEAARIWLEKVGLPEDHLFKVEDNFWDIGEGPSGPDSEIFYDRGQEF
NNLSEDDEESYPGGENERYLEIWNIVFSEFNHLPDGTYVEQPHKNIDTGMGLERLVSVIQ
NAKTNFETDLFLPIIHATEELASGPKYGNDQTADVSYKIIADHARTVSFAIGDGALPSNE
GRGYVLRRLLRRAALNGQKLGIKGAFLYKLVPVVGEIMKSYYPEVSEQADFIAKVIRLEE
ERFQETLADGLSLLNNLIEDAKASGQQVIAGRDAFKLFDTYGFPYELTFEYASDAGLAVD
QAAFEQEMAAQRERARSARTKAQSMGSQDETLMALKDNSEFVYGTFEIDDAELLEIVVND
QVVDTTNADHAQLIFDKTPFYAEMGGQVADVGQILDESGEVVANVTDVQHAPNGQNLHYV
DVILPLKKGARYQLKIDAEFRRKVQRNHTATHLLDQALRNTLGDHTHQAGSLVEPTYLRF
DFTSLEPTTPAQLVAVEKMINEKIWAQIPVETTITDQETGRKMGAIALFGEKYGDEVRVV
DIGGWSIEFCGGTHVANTGEIGLFKIVSEQAIGAGTRRIEAITSKEAFEYLNEHSNLLQQ
IKDEVKSTKVQDVPEKVNQLQVALKSSQKEAEQLQAEINRSKTGDIFDDVQEVNGLQVIA
KQIEVTSMNDLRQFADDWKSQGKSDVLILAAAIDGKANMIISLNDQALTSGLKAGAMIKS
VAATFGGGGGGRPNLAQAGGKNPAGLPAAITQAIKLIEEN
NT seq 2643 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaattatcaagtgcagaaatcagacagatgtttctcgatttcttcaaaagtaag
aatcatatggttgaaccaagttcatcactcatcccaaaggatgatcccactttgctgtgg
attaattctggtgtggccacgctgaagaagtatttcgacggttcagtaatcccgaagaat
ccacggattacgaatgcgcagaagtcgattagaacgaatgacatagagaatgtcggtaag
acggcgcgccaccatactttctttgagatgcttgggaacttctctgttggtgattacttc
aaggaggacgctattccctgggcgtgggaattcttgaccagccctaaatggcttgatttt
gatccggcaaaactttatgtgactgtttacccgaaagatacagaggctgcgcggatctgg
cttgagaaggtcggcttgccagaggatcacctcttcaaagttgaggataatttctgggat
ataggtgagggacctagtggccccgactcagagattttctacgaccgtggtcaggagttt
aataatctgagcgaagacgatgaagagagctatcctggtggtgaaaatgaacgttacctg
gagatctggaatattgtcttctccgaattcaatcacctacctgatggaacttacgttgag
cagccacataagaatatcgatacgggaatgggccttgaacgcctggtttcggtcattcag
aatgcgaagacaaacttcgagactgatctattcttaccaataattcacgcaacggaggag
ttggccagtggtcctaagtatgggaacgaccaaaccgcagatgtatcatacaaaatcatt
gcggatcacgcacggactgtgagctttgccatcggtgatggtgccttgccatcaaatgag
gggcggggctatgtcttgcggcgtttgcttcggcgcgcggctcttaatggacaaaagctg
ggtataaaaggtgcatttttgtacaaactggtaccagtggttggtgaaataatgaagtct
tactacccagaggtctcagagcaggctgatttcattgctaaagtaatcaggcttgaggaa
gagcgattccaggaaacgttggctgatggattaagtctcttgaataacctgattgaggat
gcaaaagcgagtgggcaacaagtaatcgctggacgagatgcattcaagttgtttgataca
tatggtttcccgtatgagttgacctttgaatatgcgtccgatgccgggctggccgtcgat
caagcggcctttgaacaagagatggctgcccaacgggaacgggcccgttctgcacggact
aaggcacaatccatgggttcacaggatgagaccttgatggcgctgaaggataacagtgaa
ttcgtttacggcacgttcgagattgatgacgccgaacttttagagattgtagttaacgat
caggtcgttgacacaacgaacgccgatcatgctcaattgattttcgacaaaacaccgttc
tatgcagaaatgggtggacaagtggccgatgtcggacaaattcttgacgagtctggcgag
gtagttgctaatgtgaccgatgtgcagcatgcgccaaatggtcagaatctccactacgtc
gatgtgattttgccacttaaaaagggtgcgcgatatcaattgaagattgacgcagagttt
agaagaaaagtccagcgcaatcataccgctactcacctgttggatcaggcgctgcggaat
acgttgggggatcatacacatcaagccggatccctcgttgaacctacatacctccgcttt
gatttcactagccttgagccaactacgccggcccagctcgttgcggtagagaaaatgatc
aacgaaaaaatttgggcgcaaattccggttgagaccacgattaccgaccaggagactggc
agaaagatgggtgctatcgcgttattcggtgagaaatatggcgatgaagtacgcgtggta
gacatcggcggttggtcaatcgagttctgtggtggaactcatgtggcgaataccggtgag
attggtttattcaaaattgtgtcagagcaggcgattggtgccggcaccaggaggattgaa
gccatcaccagtaaagaggcatttgaatacttgaacgagcattcgaacctgttacaacag
attaaggatgaggttaaatcgacgaaggtccaggatgtgcctgagaaggtgaaccagtta
caagttgcactaaagtcgagtcaaaaagaggccgagcaactacaggcggaaattaaccgc
agcaagaccggtgatattttcgatgacgtgcaggaagttaacggtctgcaggtgattgca
aagcagattgaagtcacaagcatgaacgatctgagacagttcgctgatgattggaagagt
caaggtaagtctgatgttctaattctggcggcagccattgatggtaaggcaaacatgatt
atttcactgaatgaccaggccttaacaagtggtctgaaagccggtgcgatgattaagagt
gttgctgcaaccttcggcggtggcggcggtggccgaccaaacttggcccaagctggtggt
aagaaccccgcaggtttaccggctgccatcacgcaagcaattaaattaatcgaagaaaac
taa

DBGET integrated database retrieval system